(data stored in ACNUC7421 zone)

EMBL: CP001854.PE114

CP001854.PE114       Location/Qualifiers
FT   CDS_pept        111262..112128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0114"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dda:Dd703_0951
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48550"
FT                   /db_xref="GOA:D3F4X2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48550.1"
FT                   /translation="MASPAFPLGLRLTGRRRSPRRRSAVTVAALAVLGLIVLLCAVGPL
FT                   LADDPSTIDNANRFAGPGTANWFGTDELGRDLFARVVDGGRISLGIAAGATVVSMLLGA
FT                   LWGFAAALGRGLLDELLMRLADVTMAIPQLLFALVFVAAFGATTAGLALIVGVLLTPVT
FT                   ARMIRSAVLSELQSDYTQAAVAYGATRSRLVLREVLPNISAPLGVQAAINAANAIVLEA
FT                   ALSFVGLGVQPPEASWGTLLQQGYQKMYQSTTGVIFPALAIFLTIWMLNLLADQLGGTD
FT                   DLRGRTG"
     atggctagcc ccgcgttccc cctcggcctg cgcctgaccg gccgccgccg ctccccgcgc        60
     cgccgctcgg ctgtgaccgt cgccgcgctc gcggtgctgg ggctgatcgt gctgctgtgc       120
     gcggtcgggc cgctgctggc ggacgacccc agcacgatcg acaacgccaa ccgcttcgcc       180
     ggccccggca ccgccaactg gttcggcacc gacgagctcg gtcgcgacct gttcgcgcgc       240
     gtcgtcgacg gcgggcgcat ctcgctcggc atcgccgccg gcgcgaccgt cgtctcgatg       300
     ctgctcggcg cgctgtgggg cttcgccgcg gcgctcggcc gcggcctgct cgacgagctg       360
     ctgatgcggc tcgccgacgt cacgatggcg atcccgcagc tgctgttcgc gctcgtcttc       420
     gtcgccgcgt tcggcgccac cacggccggc ctcgcgctga tcgtcggcgt gctgctgacg       480
     cccgtgaccg cgcggatgat ccgcagcgcc gtgctcagcg agctgcagtc cgactacacg       540
     caggcggccg tcgcctacgg cgcgacgcgc agccggctgg tgctgcgcga ggtgctgccg       600
     aacatctccg cgccgctcgg cgtgcaggcg gcgatcaacg ccgccaacgc gatcgtgctg       660
     gaggccgcgc tgagcttcgt cgggctcggc gtgcagccgc cggaggcgtc gtggggcacg       720
     ctgctgcagc agggctacca gaagatgtac cagtcgacga cgggcgtgat cttcccggcg       780
     ctggcgatct tcctgacgat ctggatgctg aacctgctcg ccgaccagct cggcggcacg       840
     gacgacctgc gaggacggac cggatga                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page