(data stored in ACNUC7421 zone)

EMBL: CP001854.PE115

CP001854.PE115       Location/Qualifiers
FT   CDS_pept        112125..113132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0115"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bph:Bphy_4502 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48551"
FT                   /db_xref="GOA:D3F4X3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X3"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB48551.1"
FT                   /translation="MSETTDTVTDAVLDVRDLRVAFGPIEPVRGVSFSLRRGERLGLVG
FT                   ESGSGKSLTALAIMRLARRAQLSGQVLLEGEDLLTLKPRQMEKVRGGRVAMVYQDPMSA
FT                   LNPVQTVGHQLEEAIRLHSRLDRRGARERAIELLDGVGVPHPQRRVEQYPHEFSGGMRQ
FT                   RVMIAMAMCADPAVLICDEPTTALDVTTQARIMDLLDRLVEDHGTAVMLITHDLGVAAG
FT                   FCDSIQVMYGGRIVERAEAEALYRAPVHPYSEALLGAAVDLSLELGVPIPTIGGQPPLA
FT                   GRLPSGCSFHPRCPHAQDVCRTDSPALESAAGRPVACHFADARAQTLEESDVRV"
     atgagcgaga ccaccgacac ggtcaccgac gcggtgctcg acgtgcgcga cctgcgcgtc        60
     gcgttcggcc cgatcgagcc ggtccgcggc gtctccttct cgctgcgcag aggcgagcgg       120
     ctcggcctcg tcggcgagtc cggctccggc aagtcgctga ccgcgctcgc gatcatgcgg       180
     ctcgcccgcc gcgcgcagct gtccggccag gtgctgctgg agggcgagga cctgctgacg       240
     ctcaagccgc gtcagatgga gaaggtccgc ggcgggcgcg tggcgatggt ctaccaggac       300
     ccgatgtcgg cgctcaaccc cgtgcagacg gtcggccacc agctggagga ggcgatccgc       360
     ctccacagcc ggctcgaccg cagaggcgcg cgcgagcgcg cgatcgagct gctcgacggc       420
     gtcggcgtgc cgcacccgca gcgccgcgtg gagcagtacc cgcacgagtt ctccggcggc       480
     atgcgccagc gcgtgatgat cgcgatggcg atgtgcgccg acccggccgt gctgatctgc       540
     gacgagccga cgaccgcgct cgacgtcacg acgcaggcgc ggatcatgga cctgctcgac       600
     cgtctcgtcg aggaccacgg caccgcggtc atgctgatca cgcacgacct cggcgtcgcg       660
     gccggcttct gcgattcgat ccaggtgatg tacggcgggc ggatcgtcga gcgcgcggag       720
     gccgaggccc tgtaccgcgc gccggtccac ccgtacagcg aggcgctgct cggcgccgcc       780
     gtcgacctgt cgctggagct gggcgtgccg atcccgacga tcggcggaca gccgccgctc       840
     gccggccggc tgccgagcgg ctgcagcttc cacccgcgtt gtccgcacgc gcaggacgtc       900
     tgccgcaccg acagcccggc gctggagtct gccgccggcc gtcccgtcgc ctgtcacttc       960
     gccgacgcgc gcgcccagac cctcgaggag tccgatgtcc gtgtctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page