(data stored in ACNUC7421 zone)

EMBL: CP001854.PE116

CP001854.PE116       Location/Qualifiers
FT   CDS_pept        113119..113973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0116"
FT                   /product="ABC transporter related protein"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: scl:sce3461 oligopeptide ABC
FT                   transporter ATP- binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48552"
FT                   /db_xref="GOA:D3F4X4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADB48552.1"
FT                   /translation="MSVSEATAAAPLVVADGLVKRFRLGRGEELTALDDVSLEIRRGET
FT                   FGLVGESGSGKSTVSRALLALLPLDGGSVRFDGVDVHALGRGDLRALRRRMQMVFQDPF
FT                   AALNRRQSVAQIVAAPLEAHGVGDRASRAQRVAEVLDLVGLGESYRERRPREMSGGQCQ
FT                   RVAIARALALDPDFVVLDESVSALDVSIQAQILNLLNELQQRLGLTYLFISHDLAVVRY
FT                   MASTVAVMQRGSIVERGTREQLFRAAEHDYTRQLMQAIPAVDPAAERARRRAARTAAAA
FT                   GAQ"
     atgtccgtgt ctgaagccac cgccgccgcg ccgctcgtcg tcgccgacgg gctcgtgaag        60
     cgcttccgcc tcggccgcgg ggaggagctg accgcgctcg acgacgtctc gctggagatc       120
     cgcagaggcg agacgttcgg cctcgtcggc gagtccggct cgggcaagtc gacggtctcg       180
     cgcgcgctgc tggcgctgct gccgctcgac ggcggcagcg tccgcttcga cggcgtcgac       240
     gtgcacgcgc tcggccgcgg cgacctgcgc gcgctgcgcc gccgcatgca gatggtcttc       300
     caggacccgt tcgcggcgct caaccggcgc cagtcggtcg cgcagatcgt cgccgcgccg       360
     ctggaggcgc acggcgtcgg cgaccgcgcc tcgcgcgcgc agcgcgtcgc cgaggtgctc       420
     gatctcgtcg gcctcggcga gagctaccgc gagcggcggc cacgcgagat gtccggtggc       480
     cagtgccagc gtgtcgcgat cgcacgggcg ctcgcgctcg acccggactt cgtcgtgctc       540
     gacgagtcgg tctcggcgct cgacgtctcg atccaggcgc agatcctcaa cctgctcaac       600
     gagctgcagc agcggctcgg gctgacgtac ctgttcatca gccacgacct cgccgtcgtc       660
     cgctacatgg cctcgacggt cgcggtgatg cagcgcggct cgatcgtcga gcgcggcacg       720
     cgcgagcagc tgttccgcgc cgccgagcac gactacacgc ggcagctgat gcaggcgatc       780
     ccggcggtcg acccggccgc ggagcgggcg cgccgccgcg cggcgcgcac cgccgcggcg       840
     gccggcgctc agtag                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page