(data stored in ACNUC7421 zone)

EMBL: CP001854.PE117

CP001854.PE117       Location/Qualifiers
FT   CDS_pept        complement(113967..114698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0117"
FT                   /product="Acetoacetate decarboxylase"
FT                   /EC_number="4.1.1.4"
FT                   /note="PFAM: Acetoacetate decarboxylase; KEGG: mlo:mlr2399
FT                   acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48553"
FT                   /db_xref="GOA:D3F4X5"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X5"
FT                   /inference="protein motif:PRIAM:4.1.1.4"
FT                   /protein_id="ADB48553.1"
FT                   /translation="MTFDPRTITSTPHGAPLVPRLPLRLRRTEILTVVYETDPSAADAL
FT                   VPEPLELAAPRVLVNVYWMHDAEFFGVYGESAVQLPVRLPDGSPAMYSPLLVLDSDAAV
FT                   AAGRELYGQPKKAGNVTLRPHGDLLVGRVERNSIDVITLTMCWKQQACAPDVLEPLVPG
FT                   SGTNVNLRVLPADGDDVTRELVVRDFEDVVVHECWTGPATIELRPNAQVPAHLLPVREV
FT                   RAATHRLVDLTLPPGRVIHRY"
     atgacgttcg acccgcgcac catcaccagc acgccgcacg gcgctccgct cgtcccgcgg        60
     ctgccgctgc gcctgcggcg gaccgagatc ctcacggtcg tctacgagac cgacccgtcc       120
     gccgccgacg cgctggtccc ggagccgctc gagctggcgg caccgcgcgt gctcgtcaac       180
     gtctactgga tgcacgacgc cgagttcttc ggcgtctacg gcgagtcggc cgtgcagctg       240
     ccggtgcggc tgccggacgg ctcgccggcg atgtactcgc cgctgctcgt gctcgactcc       300
     gacgcggcgg tcgccgccgg gcgcgagctg tacgggcagc cgaagaaggc cggcaacgtc       360
     acgctcagac cgcacggcga cctgctcgtc ggccgcgtcg agcgcaactc gatcgacgtg       420
     atcacgctga cgatgtgctg gaagcagcag gcatgcgcgc ccgacgtgct ggagccgctc       480
     gtccccggca gcggcacgaa cgtcaacctg cgcgtgctcc cggccgacgg cgacgacgtc       540
     acgcgcgagc tggtcgtgcg cgacttcgag gacgtcgtcg tgcacgagtg ctggaccggc       600
     cccgcgacga tcgagctgcg gcccaacgca caggtgccgg ctcatctgct gccggtgcgc       660
     gaggtgcgcg ccgcgacgca ccggctggtc gacctgacgc tgccgcccgg ccgcgtcatc       720
     caccgctact ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page