(data stored in ACNUC7421 zone)

EMBL: CP001854.PE118

CP001854.PE118       Location/Qualifiers
FT   CDS_pept        complement(114702..115718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0118"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding protein"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; KEGG: ypb:YPTS_1412 D-isomer specific
FT                   2-hydroxyacid dehydrogenase NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48554"
FT                   /db_xref="GOA:D3F4X6"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X6"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ADB48554.1"
FT                   /translation="MTPSDLRPRGVVVVTDSDLPTEGVAERVLEAAGWTVRRAACRTAD
FT                   DVREAAAGAVALIVQWAPVDASVLANLPDCRFVSRLGIGYDMIDVAAATEAGIPVANVP
FT                   DYCVEEVAAHTLAFVFSLTRRLPQLDAGLRAGRWAASDDGDGARRPQGTTVAVLGHGRI
FT                   GARVAQQAASVGFDVLVHDPHVPAERVEAAGHVAVTLDEALERADVVSLHVPLTPQTRH
FT                   LLDAPALARMRPGSALVNTCRGGLVDETALADALRSGQLGAAALDVFESEPLPADSPLR
FT                   DAPNLLLSPHAAWYSPIALLELEERAAQQVADFLDGRPVPTIVNPGYARVRADGAPV"
     atgaccccga gcgatctgcg cccccggggc gtcgtggtcg tcaccgactc cgacctgccg        60
     accgagggcg tcgccgagcg cgtcctcgaa gcggccggct ggacggtccg acgcgccgcc       120
     tgccgcaccg ccgacgacgt gcgcgaggcg gcagccggcg ccgtcgcgct gatcgtccag       180
     tgggcgcccg tcgacgcgag cgtgctcgcg aacctgcccg actgccgctt cgtcagccgt       240
     ctcgggatcg gctacgacat gatcgacgtc gccgccgcga cggaggccgg catcccggtc       300
     gccaacgtgc ccgactactg cgtcgaggag gtcgccgcgc acacgctcgc gttcgtcttc       360
     tcgctgacgc gccggctgcc gcagctcgac gccggcctgc gcgccggccg ctgggccgcg       420
     agcgacgacg gcgacggcgc gcggcgcccc cagggcacga ccgtcgcggt gctcggccac       480
     ggccgcatcg gcgcgcgcgt cgcgcagcag gccgcgtccg tcggcttcga cgtgctcgtc       540
     cacgacccgc acgtgccggc ggagcgggtc gaggccgccg gccacgtcgc cgtcacgctc       600
     gacgaggcgc tggagcgggc cgacgtcgtc agcctccacg tcccgctcac gccgcagacg       660
     cgtcacctgc tcgacgcgcc cgcgctcgcg cggatgcggc ctggcagcgc gctcgtcaac       720
     acctgccgcg gcgggctcgt ggacgagacg gcgctcgccg acgcgctccg ctccggccag       780
     ctcggcgccg ccgcgctcga cgtcttcgag tccgagccgc tgccggccga cagcccgctg       840
     cgcgacgcgc cgaacctgct gctctcgcca cacgccgcgt ggtactcgcc gatcgcgctg       900
     ctggagctgg aggagcgcgc cgctcagcag gtcgctgact tcctcgacgg ccgcccggtg       960
     ccgacgatcg tcaatcccgg ctacgctcgg gtgcgcgccg acggcgcccc cgtctag         1017
//

If you have problems or comments...

PBIL Back to PBIL home page