(data stored in ACNUC7421 zone)

EMBL: CP001854.PE119

CP001854.PE119       Location/Qualifiers
FT   CDS_pept        115804..117189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0119"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: acp:A2cp1_4362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48555"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48555.1"
FT                   /translation="MRTVAAPGFAGWIGVARRDVTPPPGIAQNAWGPATERRSTGVHRP
FT                   LTLTALALRDGADAAPLVLVALDGSWWRAREDEWHVREAVLAAAGGDEARAIVTLSHSH
FT                   SAPLLTRDARDFPGGELVAPYLDALRIAAAEATRDALAATVPATLTWSTGRSAVAGARD
FT                   LTVDGRPLIGWNPDAEADDTLLAGRVTAADGTVLATLVNYACHPTTLAWQNTLTSPDYV
FT                   GALRETVEDATGGAPCLFLLGAAGELAPRDQYTGDVAVADRHGRAVGHAALAALEQLPP
FT                   PGVALALHPAVESGAPLAPWWPVEHAWPDRLATTVEAFDMPLKPQPTVAELEQRWAEID
FT                   PLSRAERLRRAALMRETFGDGPAVPWRVWVWQLGGALVVAQSGEAYSLFQRELRRRFPD
FT                   RAVVVLNLANWSGPAYLPPRELYARDDAYTVWQTPLAAGCLETAIEAAAAGAARLTDEE
FT                   TVR"
     atgaggaccg ttgccgcacc cggattcgca ggctggatcg gcgtcgcccg gcgcgacgtc        60
     acgccgccgc ccggcatcgc gcagaacgcg tggggcccag cgaccgagcg ccgctcgacc       120
     ggcgtccacc ggccgctcac gctgaccgcg ctcgcgctgc gcgacggcgc cgatgcggcc       180
     ccgctcgtgc tcgtcgcgct cgacggctcg tggtggcgcg cgcgtgagga cgagtggcac       240
     gtccgcgagg cggtgctcgc ggccgccggc ggggacgagg cgcgcgcgat cgtcacgctc       300
     agccacagcc actcggcgcc gctgctgacg cgcgacgcgc gcgacttccc gggcggcgag       360
     ctggtcgcgc cgtacctcga cgcgttgcgc atcgccgccg ccgaggcgac gcgcgacgcg       420
     ctcgccgcga ccgtcccggc gacgctcacg tggtcgaccg gccgctccgc cgtcgccggc       480
     gcgcgcgacc tgaccgtcga cggccgcccg ctgatcggct ggaaccccga cgccgaggct       540
     gacgacacgc tgctcgccgg ccgcgtcacc gccgccgatg gcacggtgct cgcgacgctc       600
     gtcaactacg cctgccaccc gacgacgctc gcctggcaga acacgctcac ctcgcccgac       660
     tacgtcggcg cgctgcgtga gacggtcgaa gacgcgaccg gcggcgcacc gtgcctcttc       720
     ctgctcggcg ccgccggcga gcttgcgccg cgcgaccagt acaccggcga cgtcgccgtc       780
     gccgaccgtc acggccgcgc ggtcggccac gcggcgctcg ccgccctgga gcagctgccg       840
     ccccccggcg tcgcgctcgc gctccatccg gcggtcgagt cgggcgcgcc gctggcgccg       900
     tggtggccgg tcgagcacgc ctggccggat cggctcgcga cgacggtcga ggcgttcgac       960
     atgccgctca agccgcagcc gaccgtggca gagctggagc agcgctgggc ggagatcgac      1020
     ccgctcagcc gcgccgagcg gctgcggcgc gcggccttga tgcgcgagac gttcggcgac      1080
     gggccggcgg tgccgtggcg cgtgtgggtg tggcagctcg gcggcgcgct cgtcgtcgcg      1140
     cagtcgggcg aggcgtactc gctcttccag cgcgagctgc ggcgccgctt cccggaccgc      1200
     gccgtggtcg tgctcaacct ggcgaactgg tcgggtccgg catacctccc gccacgggag      1260
     ctgtatgcgc gcgacgatgc gtacacggtg tggcagaccc cgctcgcggc gggctgcctg      1320
     gagacggcga tcgaggccgc ggcggcgggt gccgcacggc tgacggacga ggagacggtt      1380
     cgatga                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page