(data stored in ACNUC7421 zone)

EMBL: CP001854.PE12

CP001854.PE12        Location/Qualifiers
FT   CDS_pept        15240..15998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0012"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: afw:Anae109_2456 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48448"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP4"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB48448.1"
FT                   /translation="MSVFKSLESKIAGLVEGTFSRAFRSEVRPVEIARKLAREMEEHKS
FT                   LSVSRVYVPNEYAVYLSPADRERFADLEGELVQELGGYLLEHARRERFALMSRPLIEFR
FT                   TDDRLRLGEFGIQARLVKSAAEPAAVPSQGESGHTMVYSAAERLQEPLEERARQRASTA
FT                   LLVTDGKRMVVGPAGATIGRSRDCDVVLGDANVSRKHAEVRPRGDGWMIHDLGSTNGVT
FT                   VNGTRIEQAQLLRSGDRVEIGTTLLTFELE"
     atgagcgtct tcaagagcct cgaaagcaag atcgccggcc tcgtcgaggg cacgttcagc        60
     cgtgccttcc ggtccgaggt gcggccggtc gagatcgcgc gcaagctcgc ccgcgagatg       120
     gaggagcaca agtcgctctc ggtctcgcgc gtctacgtcc cgaacgagta cgccgtctac       180
     ctctcgcctg ccgaccggga gaggttcgcc gacctcgagg gcgagctggt gcaggagctg       240
     ggcgggtacc tgctggagca cgcgcggcgc gagagattcg cgctgatgtc gcggccgttg       300
     atcgagttcc gcaccgacga ccgtctgcgg ctcggagagt tcggcatcca ggcgcggctc       360
     gtgaagtccg cggcggagcc ggccgcggtc ccgtcgcagg gcgaatccgg gcacacgatg       420
     gtctacagcg ccgccgagcg gctgcaggag ccgctggagg agcgcgcacg gcagcgcgcc       480
     tccacggcgc tgctggtcac cgacgggaag cggatggtcg tcggccccgc gggggcgacg       540
     atcggtcgca gtcgcgactg cgacgtcgtg ctgggcgacg cgaacgtctc gcgcaagcac       600
     gccgaggtgc gaccgcgcgg cgacggctgg atgatccacg acctcggctc gaccaacggc       660
     gtgaccgtga acggcacgcg gatcgagcag gcgcagctgc tgcgctccgg cgaccgcgtc       720
     gagatcggca cgacgctgct gacgttcgag ctggagtag                              759
//

If you have problems or comments...

PBIL Back to PBIL home page