(data stored in ACNUC7421 zone)

EMBL: CP001854.PE120

CP001854.PE120       Location/Qualifiers
FT   CDS_pept        117186..117935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0120"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: lch:Lcho_1203 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48556"
FT                   /db_xref="GOA:D3F4X8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48556.1"
FT                   /translation="MSGQTAVITGASSGIGRATARHLAAQGWAVASFDVSPPAEPDPAI
FT                   EDHVVDVADNAAVDAAMRSVAERHGGLQLAVNNAGITKRARLEDLTFEEWDAVVGVNLH
FT                   GAFNGTQAAGRIMLAQDGGGSIVNIVSVAADRGQPGRAPYGATKAGIVGLTKTAAVEWA
FT                   TRGVRVNAVGPGYVSSGVYEAALASGQLDNDEVLGRIPMRRLAEADEIASVIAFLASPA
FT                   ASYVTGHVLYADGGFLADFGIGVVGID"
     atgagcgggc agacagcggt gatcacgggg gcgtcgagcg gcatcggccg cgcgacggcg        60
     cgccacctcg cggcacaggg ctgggccgtc gcctcgttcg acgtgagccc gccggccgag       120
     cccgatcctg cgatcgagga ccacgtcgtc gacgtcgccg acaacgctgc ggtcgacgct       180
     gcgatgcggt cggtcgccga acgccatggc gggcttcagc tcgccgtcaa caacgccggc       240
     atcacgaagc gcgcgcggct ggaggacctg acgttcgagg agtgggacgc ggtcgtcggc       300
     gtcaacctcc acggcgcgtt caacgggacg caggcggccg ggcggatcat gctcgcgcag       360
     gacggcggcg gctcgatcgt caacatcgtc tcggtcgcgg ccgaccgcgg ccagcccggc       420
     cgcgcgccgt acggcgcgac gaaggcgggg atcgtcgggc tgacgaagac ggccgcggtc       480
     gaatgggcga cgcgcggcgt gcgtgtcaac gcggtcggtc cgggctacgt ctccagcggc       540
     gtctacgagg cggcgctcgc ctccggacag ctcgacaacg acgaggtgct cgggcggatc       600
     ccgatgcggc ggctcgccga agcggacgag atcgcctccg tgatcgcgtt cctcgcctcg       660
     ccggcggcgt cgtacgtcac cggccacgtg ctctacgccg acggcggctt cctcgccgac       720
     ttcggcatcg gcgtcgtcgg aatcgactga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page