(data stored in ACNUC7421 zone)

EMBL: CP001854.PE121

CP001854.PE121       Location/Qualifiers
FT   CDS_pept        117935..119113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0121"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bpe:BP1161 putative racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48557"
FT                   /db_xref="GOA:D3F4X9"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4X9"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ADB48557.1"
FT                   /translation="MSDAIREVRVATVALPLPRPLKLGSMEIVAREYAAATVTTEDGLS
FT                   GRAYCLTRNAPVQALVERLVTPHVVGRSSAAVEQRWDEVQRANVAVARSGVAMRALGLV
FT                   DVALWDVRAQRAGVPLWRLLAEHEGGAGAAAGGDSPGATGPRGGSAAAPDGSAPALLVA
FT                   AYPTPDRTPADVAAEVLAGAGRGFRRVKISRDPDPARMRELIERIVAGLPGDCGLVADC
FT                   GFVWRDAEQALAEIAQWGEPPLAWLEDPLVPEDADGCARIRRDGPFPLGVGDEVTEPRT
FT                   YAALLDAGALDVLRLDVLAVGGVTPSLGVLARARDAGVEVSFHVYPEISVHLAAAQPRP
FT                   AWVELFDAEVPGGNPYDPAHLLVAGDPPLRDGRWVASDRPGLGLAFDEERVR"
     atgagcgacg cgatccgcga ggtccgcgtc gcgaccgtcg cgctgccgct gccgcgcccg        60
     ctgaagctcg ggtcgatgga gatcgtcgcg cgcgagtacg cggcggcgac ggtcacgacc       120
     gaggacgggt tgagcggtcg cgcgtactgc ctcacgcgca acgcaccggt tcaggcgctg       180
     gtcgagcggc ttgtgacgcc gcacgtcgtc ggtcgctcgt ccgccgcggt cgagcagcgc       240
     tgggacgagg tccagcgcgc gaacgtcgcc gtcgcccgct ccggcgtcgc gatgcgcgcg       300
     ctcgggctgg tcgacgtcgc gctgtgggac gtgcgcgcgc agcgtgccgg cgtgcccctg       360
     tggcggctgc tggcggagca cgaaggcggg gcgggcgcgg cggccggagg cgacagcccc       420
     ggcgcgaccg gtccgcgcgg aggctccgcg gcggcgcccg acggctccgc gcccgcgctg       480
     ctcgtcgccg cctacccgac gccggaccgc acgccggcgg acgtcgccgc cgaagtcctg       540
     gccggcgccg ggcgcggctt ccgccgcgtg aagatcagcc gcgacccgga cccggcgcgg       600
     atgcgcgagc tgatcgagcg gatcgtcgcc gggcttcccg gcgactgcgg gctcgtcgcc       660
     gactgcggct tcgtctggcg cgacgccgag caggcgctcg ccgagatcgc gcagtggggc       720
     gagccgccgc tcgcgtggct ggaggacccg ctcgtgcccg aggatgcgga cggctgcgcg       780
     cggatccgcc gcgacggccc gttcccgctc ggcgtcggcg acgaggtgac cgagccgcgc       840
     acgtacgccg cgctgctcga cgccggcgcg ctcgacgtgc tgcggctcga cgtgctcgcg       900
     gtcgggggcg tgacgccgtc gcttggcgtg ctcgctcgcg cgcgcgacgc cggcgtcgag       960
     gtctcgttcc acgtctaccc ggagatcagc gtgcacctcg ccgcggcgca gccgcgcccg      1020
     gcgtgggtcg agctgttcga cgcggaggtc cccggcggca acccgtacga tcccgcacat      1080
     ctgctggtcg ccggagatcc gccgctgcgg gacggtcgct gggtcgcgtc cgaccggccc      1140
     gggctcggcc tggcgttcga cgaggagcgc gtgagatga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page