(data stored in ACNUC7421 zone)

EMBL: CP001854.PE122

CP001854.PE122       Location/Qualifiers
FT   CDS_pept        119110..119892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0122"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: smd:Smed_1437 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48558"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y0"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48558.1"
FT                   /translation="MSSVVVTGAGTGIGRAIAERLAADGWAVVALEHDAALASELEGVV
FT                   AATVVGDAGDRDDIAAAVTAAEALAPLGGWVNNAGITTQGTLHDPDPEQVRRLLSVNVD
FT                   GVYWGCSAAVRSFTERGAPGAIVNISSIHGRAGAVAHAAYDTSKGAIDALTRHVASAYG
FT                   PYGIRANAIAPGAVMTQALERSFEEADDGAARRAGLERQAPLRRIGEPAEIAAVAAFLL
FT                   SEQASFLTGQSIAVDGGWTTALVPPPLDPELAERYGLR"
     atgagcagcg tcgtcgtgac gggagcgggc accggcatcg gccgcgcgat cgccgagcgg        60
     ctcgcggcgg acggctgggc ggtcgtcgcg ctcgagcacg acgcggcact ggcgtcggag       120
     ctggagggcg tcgtcgccgc gacggtcgtc ggcgacgccg gtgaccgcga cgacatcgcc       180
     gccgcggtca ccgcggccga ggcgctcgcg ccgctgggcg gctgggtcaa caacgccggc       240
     atcacgacgc aggggacgct gcacgacccc gatcccgagc aggtgcggcg gctgctgtcc       300
     gtcaacgtcg acggcgtcta ctggggctgc tcggcggccg tgcgctcgtt caccgagcgc       360
     ggcgcgccgg gcgcgatcgt caacatctcc tcgatccacg gccgcgcggg cgcggtcgca       420
     cacgccgcct acgacacgtc gaagggcgcg atcgacgcgc tcacccgcca cgtcgcctcc       480
     gcctacggcc cgtacgggat ccgcgccaac gcgatcgccc ccggggcggt catgacgcag       540
     gcgctggaac ggagcttcga ggaggccgac gacggcgccg cgcgccgcgc cgggctggag       600
     cgtcaggcgc cgctgcgccg gatcggcgag ccggccgaga tcgccgccgt cgccgcgttc       660
     ctgctgtccg agcaggcgtc gttcctgacc ggccagtcga tcgcggtcga cggcggctgg       720
     acgaccgcgc tcgtgccgcc cccgctcgac ccggagctgg cggagcggta cgggctgaga       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page