(data stored in ACNUC7421 zone)

EMBL: CP001854.PE123

CP001854.PE123       Location/Qualifiers
FT   CDS_pept        119889..121031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0123"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   afw:Anae109_4188 beta-lactamase domain- containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48559"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ADB48559.1"
FT                   /translation="MSGAAGVAGASGAAGASAVAGVGGAAGAAGAGGVGRIARIVEPLD
FT                   DGRFLSVFLLVGARGAVLVDTGLAATPERTIGPALAARGLGWEDLTAVVVTHADVDHAG
FT                   GLGAVRRLAPQATTICGARDRALIESAELLLERRYREFRADHAIDQSRDFVAWVRANAD
FT                   DGTIDAVFDGDATLTVDDGTVTLARPAGAAPRDDRPPADPARGGPPRDAGAWRVSLLAV
FT                   PGHTAGHLALHDAASGTAIAADAVLGAAAPGADGAPAFAPTYRFLPAYRDTIARLRGLG
FT                   AERLLCSHLEPLDGAAAGAYLDESAAFATALERALLSSLADGREATLAQLIALAAPAVA
FT                   TWPPDANHTLAQPLLGHVEELCARGRIRRRPGLPARYALA"
     atgagcgggg cggctggtgt ggctggcgcg agcggggccg ctggcgcgag cgccgtggcc        60
     ggcgtcggcg gcgcggctgg tgcggctggt gccggcggcg tcggccggat cgcgcggatc       120
     gtcgagccgc tcgacgacgg ccgcttcctg tccgtcttcc tgctcgtcgg cgcgcgcggg       180
     gcggtgctcg tcgacacggg cctcgccgcg acgcctgagc gcacgatcgg gccggcgctc       240
     gcggcgcgcg ggctcggctg ggaggacctg accgcggtcg tcgtgacgca cgccgacgtc       300
     gaccacgccg gcggcctcgg cgcggtccgt cggctcgcgc cgcaggcgac gacgatctgc       360
     ggcgcgcgtg accgcgcgct gatcgagtcg gccgagctgc tgctggagcg gcgctaccgc       420
     gagttccgcg ccgaccacgc gatcgaccag tcgcgcgact tcgtcgcctg ggtccgcgcg       480
     aacgccgacg acggcacgat cgacgccgtc ttcgacggcg acgcgacgct gacggtggac       540
     gacgggacgg tcacgctcgc gcgtcccgcc ggcgccgcgc cgcgtgacga ccgtccgccc       600
     gccgaccctg cgcgtggcgg cccgccgcgc gacgccggcg cgtggagggt ctcgctcctc       660
     gccgtccccg gtcacaccgc cggccacctc gcgctgcatg acgcggcgag cggtacggcg       720
     atcgcggccg acgcggtcct cggcgccgcc gcgccgggcg ccgacggcgc gcccgcgttc       780
     gccccgacgt accgcttcct gcccgcgtac cgcgacacga tcgcgcggct gcgcgggctc       840
     ggcgccgagc gcctgctgtg ctcccatctc gaaccgctcg acggggcggc ggccggcgcc       900
     tacctcgacg agagcgcggc gttcgccacg gcgctggagc gggcgctgct cagctccctc       960
     gccgacggcc gcgaggcgac gctcgcgcag ctgatcgcgc tcgccgcccc ggcggtcgcc      1020
     acatggccgc cggacgcgaa ccacacgctc gcccagccgc tgctcggcca cgtcgaggag      1080
     ctgtgcgcgc gcggccgcat ccgccgccgc ccgggcctcc ccgcgcgcta cgcgctcgcc      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page