(data stored in ACNUC7421 zone)

EMBL: CP001854.PE124

CP001854.PE124       Location/Qualifiers
FT   CDS_pept        121203..123128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0124"
FT                   /product="Endopygalactorunase-like protein"
FT                   /note="KEGG: Os09g0487600; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48560"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y2"
FT                   /inference="protein motif:COG:COG5434"
FT                   /protein_id="ADB48560.1"
FT                   /translation="MRWSLRGSLLAAAALMLGLPAAASALDVDVTAAPYSAAGDGVTND
FT                   RAAIQRAIGDVASAGGGKVTLPAPKTYLTGNLHLRTNVELHIARGAKVKQSQEITHYAD
FT                   RPLRGALIDETIPWNFTFYRNYPLIYGGSVRNVKLTGAGTIEMTQLPDASQTIRTNAIG
FT                   MWDVSGFEISGIHAIGGTTPYVGLYFNDNGVVRDTTLNEPGGPTVSGIEVVSSQHILVE
FT                   RNLMRDPDGTPGVTDDGIALSTTYGDPRATGWWRSDVPRPLVDVVIRDNIVEAECCSAL
FT                   AFIPWGTSAPDQRDIEFRDIRIENNVLNAPGSWDSVKCWCDNPWRGSYGPAYTAVEDDQ
FT                   APMTNVTFSGNSYAGSLDGFVRARISGIQGASFHPGNPYLKNGGFEETGIAYWSKSGTA
FT                   RQVGAETFAAGQTGRWFGYITNFGDGYTALAQGVGLPASTSYTFRARVQTSGDPVRMYV
FT                   HNQCTGATVAAKWVSGTGWSTEDLSFTTTSACSNYHVGIDSSGQTRGWGRIDDARLLGS
FT                   VIEDGDPRIGYAGLWHQNVHPSDSGGTHMLAVADRTTANVTFEGNRARWRTIVGPNGGY
FT                   ADVWLDGVFKGTVDTYSASYGWAEIYDTGVLSRGTHVLGIRPQWAKNPLSTYTYVTIDA
FT                   INVSGW"
     atgaggtggt ccctgcgcgg gagcctgctg gctgccgcgg cgctgatgct cggcctgccg        60
     gccgcggcca gcgcactcga cgtggacgtc accgcggcgc cgtacagcgc cgccggtgac       120
     ggcgtgacga acgaccgggc ggcgattcag agagcgatcg gcgacgtcgc ctccgccggt       180
     ggcggcaagg tgacgttgcc ggcgccgaag acatacctga ccggcaacct gcatctcaga       240
     acgaacgtcg agctgcacat cgccagaggc gcgaaggtca agcagagcca ggagatcacc       300
     cactacgccg acagaccgct gcgcggggcg ctgatcgacg agacgatccc gtggaacttc       360
     accttctacc gcaactaccc gctgatctac ggcggcagcg tcagaaacgt gaagctgacc       420
     ggtgccggca cgatcgagat gacgcagctc ccggacgcga gccagacgat tcgcaccaac       480
     gcgatcggga tgtgggacgt ctccgggttc gagatctccg gcatccatgc gatcggcggc       540
     acgacgccgt acgtcggcct ctacttcaac gacaacgggg tcgtgcgcga cacgacgctc       600
     aacgagccgg gcggaccgac cgtctccggc atcgaggtcg tcagctcaca gcacatcctc       660
     gtcgagagaa acctgatgcg cgacccggac ggcacccccg gcgtcaccga cgacgggatc       720
     gccctgtcga cgacctacgg cgacccgcgc gccaccggct ggtggagaag cgacgtgccg       780
     agaccgctcg tcgacgtcgt gatccgcgac aacatcgtgg aggcggagtg ctgcagcgcg       840
     ctggcgttca tcccgtgggg cacctcggcg cccgaccagc gcgacatcga gttccgcgac       900
     atccggatcg agaacaacgt cctcaacgcg ccgggcagct gggactccgt caagtgctgg       960
     tgcgacaacc cgtggagagg ttcctacggg ccggcgtaca cggcggtcga ggacgaccag      1020
     gcgcccatga ccaatgtgac gttctccggc aacagctacg ccggcagtct cgacgggttc      1080
     gtgagagcga gaatcagcgg gatccagggc gcgtcgttcc accccggcaa cccgtacctc      1140
     aagaacggcg gcttcgaaga gaccgggatc gcgtactggt cgaaatcggg caccgcgaga      1200
     caggtcggcg ctgagacctt cgcggccggt cagaccggca gatggttcgg ctacatcacc      1260
     aacttcggcg acggctacac cgcgctcgcg cagggcgtcg gcctgccggc gagcacgagc      1320
     tacacgttcc gcgccagggt gcagacgagc ggcgacccgg tgcggatgta cgtccacaac      1380
     cagtgcacgg gcgcgacggt cgcggccaaa tgggtcagcg ggacgggctg gtcgaccgag      1440
     gacctgtcgt tcacgaccac ctcggcctgc tcgaactacc acgtcgggat cgactcctcc      1500
     ggccagacga gaggctgggg ccggatcgac gacgcgcggc tgctcggcag cgtgatcgag      1560
     gacggcgacc cgcggatcgg ctacgccggc ctctggcacc agaacgtcca tccgagcgac      1620
     tccggcggca cgcacatgct cgccgtcgcc gacagaacga ccgcgaacgt cacgttcgag      1680
     ggcaaccgcg ccagatggcg gacgatcgtc ggccccaacg gcggctatgc cgacgtctgg      1740
     ctcgacggcg tcttcaaggg cacggtcgac acgtacagcg cgagctacgg ctgggccgag      1800
     atctacgaca ccggggtgct gagcagaggc acgcacgtgc tcgggatacg gccgcagtgg      1860
     gcgaagaacc cgctctcgac gtacacctac gtgacgatcg acgcgatcaa cgtctcgggg      1920
     tggtga                                                                 1926
//

If you have problems or comments...

PBIL Back to PBIL home page