(data stored in ACNUC7421 zone)

EMBL: CP001854.PE125

CP001854.PE125       Location/Qualifiers
FT   CDS_pept        123264..125165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0125"
FT                   /product="Endopygalactorunase-like protein"
FT                   /note="KEGG: Os09g0487600; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48561"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y3"
FT                   /inference="protein motif:COG:COG5434"
FT                   /protein_id="ADB48561.1"
FT                   /translation="MRRLLVSGLVAAVTACLALPAAASALDVDVTAAPYGAAGDGVTND
FT                   RAAIQSAIDDVSAAGGGKVTLPAPRTFLSGDVSVKSNVTLEIAGGATLKMSQNQSHWAH
FT                   RPVLGHMIDGTIEWNIAMYRNYPLIHSGNARNVTVTGGGTIEMTRALTDETTIHAMGIG
FT                   FHKVDGFRISNLTMIGASASNVSLYTVDNGIVSGMTMRDDLDTNVEGVAIGNSQHVRVT
FT                   GNTMDATSDDTIVLWTQWNDPRGTTWWSTAVPEPINDIEIDNNYATSTCCKAIALIPWG
FT                   TAYGDQRQVEMSDVRVHDNTLAATDAVGCWCDDPYTGEPPSRFTNQEQDQAPMKDLTFA
FT                   RNRYTGSTALTKAHIQNLVADFAKTSPTFIRNGGFERTGHAYWSRVSRAGQSDAADYSV
FT                   GQNGSWYGYIQYFDVGYTTLYQGVSLTGGQTYTLRARIQTPDGSPARMYVYDTCGGTGV
FT                   TQNVSSLAWTDVSLRFTAASSCGRYIVGFDSGTFTSGGLRVDDVLLEGPRIDNDDPVIS
FT                   YEGLWYLYERAGDHGGTERMATQAGTRSSATVTFRGTRARVLAVRGGDRGRADVYLDGV
FT                   YKTTIDQYSPTTDLQYVTYDTGTVAAGTHELRVVPTWTKHPASANTVISVDAVEVVR"
     atgcgacgac tgcttgtcag cggcctggtg gccgcggtga cggcatgcct tgccctgccc        60
     gcggccgcct ccgcgctcga cgtggacgtg accgcagcgc cgtatggagc tgccggggac       120
     ggcgtgacga acgaccgtgc ggcgatccag agcgcgatcg acgacgtcag cgcggcgggt       180
     ggcgggaagg tgacgctgcc cgcgccgagg acgttcctgt ccggcgacgt ctcggtcaag       240
     agcaacgtga cgctggagat cgccggcggc gcgacgctga agatgagcca gaaccagtcg       300
     cactgggcgc acagaccggt gctcggccac atgatcgacg gcacgatcga gtggaacatc       360
     gcgatgtacc ggaactatcc gctgatccat tccggcaacg cgagaaacgt caccgtgacg       420
     ggcggcggca cgatcgagat gacgcgcgcg ctgaccgacg agacgacgat ccacgcgatg       480
     gggatcggct tccacaaggt cgacgggttc agaatctcca acctgacgat gatcggcgcg       540
     agcgcgagca acgtctcgct ctacaccgtc gacaacggga tcgtctccgg gatgacgatg       600
     agagacgacc tcgacaccaa cgtcgagggc gtcgcgatcg gcaactcgca gcacgtgcgc       660
     gtcaccggca acacgatgga cgcgaccagc gacgacacga tcgtgctgtg gacgcagtgg       720
     aacgacccgc gcggcacgac gtggtggtcg acggccgtgc ccgagccgat caacgacatc       780
     gagatcgaca acaactacgc gacctcgacc tgctgcaagg cgatcgcgct gatcccctgg       840
     ggcaccgcgt acggcgacca gcgccaggtc gagatgagcg acgtgcgcgt ccacgacaac       900
     acgctcgcgg cgaccgacgc ggtcggctgc tggtgcgacg acccgtacac cggcgagccg       960
     ccgtcgagat tcaccaacca ggagcaggac caggcgccga tgaaggacct gacgttcgcc      1020
     agaaacagat acaccggatc gaccgcgctg acgaaggcgc acatccagaa cctcgtcgcc      1080
     gacttcgcca agacgagccc gacgttcatc cgcaacggcg gcttcgagcg caccggccac      1140
     gcgtactggt cgcgcgtgag cagagccggc cagtccgacg ccgccgacta ctccgtcggc      1200
     cagaacggct cgtggtacgg ctacatccag tacttcgacg tcggctacac gacgctctac      1260
     cagggcgtgt cgctgaccgg cgggcagacg tacacgctgc gcgcgcggat ccagacaccg      1320
     gacgggagcc cggcgcggat gtatgtgtac gacacgtgcg gcggcacggg cgtgacgcag      1380
     aacgtcagct cgctcgcgtg gaccgacgtc agcctcagat tcaccgcggc gtcgagctgc      1440
     ggccggtaca tagtcgggtt cgactcgggc acgttcacct caggcggcct gcgcgtcgac      1500
     gacgtgctgc tcgaagggcc gcggatcgac aacgacgacc cggtgatctc gtacgagggc      1560
     ctctggtacc tctacgagcg cgccggcgac cacggcggga cggagcggat ggcgacgcag      1620
     gccggcacca gatcgagcgc gaccgtcacg ttccgtggca cgcgcgcgag agtgctcgcc      1680
     gtccgcggcg gcgaccgcgg cagagccgac gtctacctcg acggcgtcta caagacgacg      1740
     atcgaccagt acagcccgac gaccgacctg cagtacgtca cgtacgacac cggcacggtc      1800
     gcggccggga cgcacgagct gagagtggtg ccgacctgga ccaagcaccc cgcgtcggcg      1860
     aacacggtga tctcggtcga cgcggtcgag gtcgtacggt ag                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page