(data stored in ACNUC7421 zone)

EMBL: CP001854.PE126

CP001854.PE126       Location/Qualifiers
FT   CDS_pept        125170..125922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0126"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   csa:Csal_1825 3-hydroxybutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48562"
FT                   /db_xref="GOA:D3F4Y4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADB48562.1"
FT                   /translation="MNADRRPAALVTGAAGGIGGAIVAALGDAGWDVLAVDLRPDPETG
FT                   PGASFAADLTTREGNRAAVEHALDRFGRLDAIVANAGMQHVAPVADFPEDRWDALLALM
FT                   LTSPFLLAKYAWPALAASGDGRIVAVASAHAQVASPFKSAYVSAKHGVLGLVKTLALEG
FT                   AEQGITATAVCPGFVRTPLVEAQIGDQARAHGLPEEDVLRDVILAPHAVKRLLEPEEIA
FT                   ATVAFLLGPAGRAFTGVPVTMDLGWTAR"
     atgaacgcag acagacggcc ggcggcgctc gtgacgggtg ccgccggcgg catcggcggc        60
     gcgatcgtcg ccgccctcgg cgacgccggc tgggacgtgc tcgccgtcga cctgcgcccg       120
     gacccggaga cggggccggg cgcgtcgttc gccgccgacc tgaccacccg cgaggggaac       180
     cgcgccgcgg tcgagcacgc gctcgaccgc ttcggccggc tcgacgcgat cgtcgccaac       240
     gccgggatgc agcacgtcgc gcccgtcgcc gacttccccg aggaccgctg ggacgcgctg       300
     ctggcgctga tgctgacgag cccgttcctg ctcgcgaagt acgcctggcc ggcgctcgcc       360
     gcctcgggcg acggacggat cgtcgcggtc gcctcggcgc acgcgcaggt cgcctcgccg       420
     ttcaagtcgg cgtacgtgtc ggccaagcac ggcgtgctcg ggctggtcaa gacgctcgcg       480
     ctcgaaggcg ccgagcaggg gatcacggcg accgccgtct gcccgggctt cgtccgcacc       540
     ccgctcgtcg aggcgcagat cggcgaccag gcgcgcgcgc acggcctgcc ggaggaggac       600
     gtgctgcgcg acgtgatcct cgcgccgcac gccgtcaagc ggctgctcga accggaggag       660
     atcgccgcga ccgtcgcctt cctgctcggc cccgccggcc gcgccttcac gggcgtgccg       720
     gtgacgatgg acctcggctg gaccgcgcgc tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page