(data stored in ACNUC7421 zone)

EMBL: CP001854.PE127

CP001854.PE127       Location/Qualifiers
FT   CDS_pept        complement(126012..128807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0127"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; Collagen triple
FT                   helix repeat; SMART: PKD domain containing protein; KEGG:
FT                   bpt:Bpet2847 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48563"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008160"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR024535"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y5"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADB48563.1"
FT                   /translation="MSLWSTARRAVPTALVAAAAVGAVASAPAAAAPGDPSADVTAAPY
FT                   NAAGDDTTNDRAAIQQAIDDIGARGGGEVIVPAGRTFLTGSLKLRSGVTLRLDGTLRQS
FT                   QDVAHYAKAPIPGLDMPTDIPWHRAYFHNDPLIGAIGVHDVAIVGSGKLQMTVQADHTR
FT                   RIDIIPVGFFEAQRFTLRGITIREARTTIITMLHSSDGLVANNDVATSPDLGADGIVVS
FT                   GSQRVRVLHNRVRTSDDNFVLETKHLDPRDQDSWWSSATSTPLKDIELAYNDAENFGAR
FT                   YSIAFLPWASTPADKRDAAISDIWIHDNRLVSRNDTWVYCDCDNPFNPERRPFIQPTRR
FT                   GEQAPMTRIVMERNTYDGRMWPFYSWVPPVFTDSRFEIARANAPALMNGDFERTAAVWW
FT                   SPEGNAGATDDPAEVPEAAEAAFARRGGSFAAYLETRRNQRAALYQGISLKNAATLQMP
FT                   RLGLGNRAVYTFEANVVTSGHAFALVARDTCANRELARRLVAPRSFRRERLLIPVETNC
FT                   DLVRVGIERTAANGAWALLDDAELHMPVIDSEDPRWVLRGMWMRDWSGWDVGETDHHAG
FT                   DDGGSAALTYTGGQAKLISARKPWGGIVEMSVDGAARGDVDLYGSQQIGGLEVFDTGTL
FT                   SSGRHTLRLTITGRKNAASENDYGIFDAIVVPEWVNPAAPAAHLEELRPDLGAVVVPGR
FT                   ALVGHPVYVEAPAYAPRGGGVTVGWRLGDGTTTSGSKANHVYDAPGTYTVTVEARDTHG
FT                   ETTTATRTIVVRAGPSGLAGLDGAAGADGTDGAPGERGADGPAGPAGAAGATGATGPAG
FT                   ATGAGGPTGARGAAGPKGDAGDPANVSVSCTLVKRRTAVRCTVAATRARARGAARVSGT
FT                   FRTAGTTARAAGSGRVAVTLRPAQRPTKSARVAVRLRVDGIAKDLVVPLGTTRSVALPR
FT                   R"
     atgtccctgt ggtccaccgc gcgacgcgcg gtacccaccg cgctcgtcgc cgccgccgct        60
     gtcggcgccg tcgcgagcgc acccgccgcc gcggcgccgg gagacccgtc ggccgacgtg       120
     acggcggcgc cgtacaacgc ggccggcgac gacacgacga acgatcgcgc cgcgatccaa       180
     caggcgatcg acgacatcgg cgccagaggc ggcggcgagg tgatcgtgcc ggccggcaga       240
     acgttcctga cgggcagcct gaagctgaga tccggcgtca cgctgcggct cgacggcacg       300
     ctgagacaga gccaggacgt cgcccactac gcgaaggcgc cgatcccggg cctcgacatg       360
     ccgacggaca tcccctggca tcgcgcgtac ttccacaacg atccgctgat cggcgcgata       420
     ggcgtccacg acgtcgcgat cgtcggcagc ggcaagctgc agatgaccgt ccaggccgat       480
     cacacgagac ggatcgacat catccccgtc ggcttcttcg aggcacagcg cttcaccctc       540
     cgcggcatca cgatccgcga ggcgcgcacg acgatcatca cgatgctgca ctccagcgac       600
     ggcctcgtcg cgaacaacga cgtcgcgacc tcgcccgacc tcggcgccga cggcatcgtc       660
     gtcagcggct cgcagcgcgt gagagtgctg cacaacagag tccgcacgag cgacgacaac       720
     ttcgttctgg agacgaagca cctcgacccg cgtgaccagg attcgtggtg gagctcggcg       780
     acctcgacgc cgctgaagga catcgagctg gcgtacaacg acgccgagaa cttcggcgcg       840
     cgctactcga tcgcgttcct cccgtgggcg agcacgccgg ccgacaagcg cgacgccgcg       900
     atctccgaca tctggatcca cgacaacaga ctcgtgtcga gaaacgacac gtgggtctac       960
     tgcgactgcg acaacccgtt caacccggag agaagaccgt tcatccagcc gacccggcgc      1020
     ggcgagcagg cgccgatgac gcggatcgtg atggagagaa acacctacga cggcagaatg      1080
     tggccgttct actcgtgggt cccgcccgtc ttcaccgact cgcgcttcga gatcgcgcgc      1140
     gcgaacgcac cggcgctgat gaacggcgac ttcgagagaa ccgcggccgt ctggtggagc      1200
     cccgagggca acgccggcgc gaccgacgac ccggccgagg tgccggaagc ggccgaggcc      1260
     gcgttcgcga gacgcggcgg cagcttcgcc gcgtacctgg agacgcgccg caatcagaga      1320
     gccgcgctct accagggaat cagcctgaag aacgccgcca cgctgcagat gccgcgtctc      1380
     ggcctcggca acagagcggt ctacacgttc gaggcgaacg tcgtcacgag cggccacgcg      1440
     ttcgcgctcg tcgcgcgcga cacctgcgcg aacagagagc tggcacgacg gctcgtcgcc      1500
     ccgcgcagct tccgccgcga gcggctgctg atcccggtcg agacgaactg cgacctcgtc      1560
     cgcgtcggga tcgagcggac cgccgcgaac ggcgcctggg cgctgctcga cgacgccgag      1620
     ctgcacatgc cggtgatcga cagcgaggac ccgcgctggg tcctgagagg catgtggatg      1680
     cgcgactggt cgggctggga cgtcggcgag accgaccacc acgccggcga cgacggcggc      1740
     tccgcggcgc tgacgtacac cggcgggcag gcgaagctga tctccgccag aaagccgtgg      1800
     ggaggaatcg tcgagatgtc ggtcgacggg gcggcgagag gcgacgtcga cctctacggc      1860
     agccagcaga tcggcgggct cgaggtgttc gacacgggca ccctgagcag cggcagacac      1920
     acgctgagac tcaccatcac gggccgcaag aacgcggcgt cggagaacga ctacggcatc      1980
     ttcgacgcga tcgtcgtgcc ggagtgggtc aaccccgccg cgcccgccgc gcacctcgag      2040
     gagctgcgtc cggacctcgg cgcggtcgtc gtgccgggca gagcgctcgt cggccacccg      2100
     gtctacgtgg aggcgcccgc gtacgcgccg cgcggcggcg gcgtgacggt cggctggaga      2160
     ctcggcgacg gcacgacgac gagcggttcg aaggccaacc acgtctacga cgcgcccggc      2220
     acgtacaccg tgacggtcga ggcgagagac acgcacggcg agacgacgac ggcgacgcgc      2280
     acgatcgtcg tcagagcggg cccgtcgggc ctcgcaggcc tggacggcgc ggccggcgct      2340
     gacggaaccg acggggcgcc cggcgagcgt ggggccgacg gtccggcagg gcctgcgggc      2400
     gcggccggcg cgacgggcgc gaccggtccg gccggcgcaa cgggcgcagg cggcccgacc      2460
     ggggcgcgcg gcgccgctgg gccgaagggc gacgcgggcg atccggcgaa cgtgtcggtc      2520
     agctgcacgc tcgtcaagcg ccgcacggcg gtgcgctgca ccgtggcggc gacgagagcg      2580
     cgggcgcgcg gagcggcgcg cgtgagcgga acgttccgca cggccgggac gacggcgcgc      2640
     gccgccggct cgggccgcgt cgccgtcacg ctgcgtccgg cgcagcggcc cacgaagagc      2700
     gcgcgcgtcg cggtgcggct gcgcgtcgac gggatcgcga aggacctggt cgtgccgctc      2760
     ggcacgacgc gaagcgtcgc gctgccgcgt aggtag                                2796
//

If you have problems or comments...

PBIL Back to PBIL home page