(data stored in ACNUC7421 zone)

EMBL: CP001854.PE128

CP001854.PE128       Location/Qualifiers
FT   CDS_pept        complement(128870..130204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0128"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="KEGG: ara:Arad_12308 histidinol dehydrogenase;
FT                   TIGRFAM: histidinol dehydrogenase; PFAM: Histidinol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48564"
FT                   /db_xref="GOA:D3F4Y6"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y6"
FT                   /inference="protein motif:TFAM:TIGR00069"
FT                   /protein_id="ADB48564.1"
FT                   /translation="MAEVLKAARDGWTGARTRSGRATSEGGDRANGASDPAVVATVAEI
FT                   IGAVRERGDAAVRELSARFDRWEPESFRLTTEQIDACVAQVSEQALADLRWCQEQVRAF
FT                   ALAQRASLHDVEVETQPGVRLGHRHVPIARVGAYIPGGRYPMIASAAMSILTAKAAGVE
FT                   HVIACTPPLDGAPPALTVAAMQLAGADEIHVLGGVQAVAAMAVGTETIERVDFLAGPGN
FT                   AYVAEAKRQLFGEVGIDLFAGPTEILVVADETADPEIVAADLLGQAEHGLTSPAALIAT
FT                   DAGLARAALAEIERQLQTLPTADVAGPAWRDYGEVHLVGDREEAAALADAFAYEHVEIL
FT                   TAEPRWFLDTLRQYGALFLGEGTTVAYGDKAIGTNHVLPTAGAARYTGGLWVGKFLKTV
FT                   TYQECDPAASARIGEICARQCRLEHFEGHARSCDVRVRKYAGALV"
     atggcagagg ttctgaaggc ggcgagagac ggctggacgg gcgcgcggac gcggtccggt        60
     cgggcgacga gcgagggcgg cgacagagcg aacggcgcga gcgatccggc ggtcgtcgcg       120
     accgtcgccg agatcatcgg cgcggtccgc gagcgcgggg acgcggcggt gcgggagctg       180
     tcagcgcggt tcgaccgctg ggagccggag tcgttccggc tcacgaccga gcagatcgac       240
     gcgtgcgtcg cgcaggtgag cgagcaggcg ctggcggatc tgcgctggtg ccaggagcag       300
     gtccgcgcct tcgcgctcgc gcagcgggcg tcgctgcacg acgtcgaggt cgagacgcag       360
     ccgggcgtgc ggctcgggca ccgccacgtg ccgatcgcgc gcgtcggcgc gtacatcccc       420
     ggcgggcgct acccgatgat cgcctccgcc gcgatgtcga tcctgacggc gaaggcggcc       480
     ggcgtagagc acgtgatcgc gtgcacgccg ccgctggacg gcgcgccccc ggcgctcacc       540
     gtcgccgcga tgcagctcgc gggcgccgac gagatccacg tgctcggcgg cgtccaggcg       600
     gtcgccgcga tggccgtcgg gaccgagacg atcgagcgcg tcgacttcct cgccgggccc       660
     ggcaacgcgt acgtcgccga ggcgaagcgg cagctgttcg gcgaggtcgg gatcgacctc       720
     ttcgccggcc cgaccgagat cctcgtggtc gccgacgaga ccgccgaccc ggagatcgtc       780
     gccgccgacc tgctcggcca ggccgagcac ggcctgacct cgccggccgc gctgatcgcg       840
     accgacgcgg gcctcgcgcg cgcggcgctc gccgagatcg agcgtcagct ccagacgctg       900
     ccgaccgccg acgtcgccgg cccggcgtgg cgcgactacg gcgaggtcca cctcgtcggc       960
     gaccgcgagg aggcggccgc gctggccgac gcgttcgcct acgagcacgt cgagatcctg      1020
     accgcggagc cgcgctggtt cctcgacacg ctgcgccagt acggcgcgct cttcctcggc      1080
     gagggcacaa ccgtcgcgta cggcgacaag gcgatcggca ccaaccacgt gctgccgacc      1140
     gccggcgccg cccgctacac cggcggcctc tgggtcggga agttcctcaa gaccgtcacg      1200
     taccaggagt gcgacccggc ggcgagcgcg cggatcgggg agatctgcgc ccgtcagtgc      1260
     cgcctggagc acttcgaagg ccacgcgcgc agctgtgacg tgcgcgtgcg caagtacgcc      1320
     ggcgcgctcg tctag                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page