(data stored in ACNUC7421 zone)

EMBL: CP001854.PE129

CP001854.PE129       Location/Qualifiers
FT   CDS_pept        130338..131336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0129"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: pol:Bpro_5109 LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48565"
FT                   /db_xref="GOA:D3F4Y7"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y7"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ADB48565.1"
FT                   /translation="MAVTSRDIAREIGLSQSTVSRALRGDPRVTPATRERVREAAERLR
FT                   YVPDAAARTLTTGRTQIVGVVVADITNPFYPEIVEVLHGELGQEGYATVLLNEPRADDL
FT                   AGQLRGRSVDGLIVVSALLDEQFARQLSRLGMPVVLLNRDVDDTAVDCVVSDNVAGGAL
FT                   AADHLLALGHRRIGLVAGPANTSTARDRERGMRQALAQHGVPLDDSLRRSGSFSHHSGH
FT                   QGCLELLRLPQPPTALVCASDVVAFGALDAAKRLGVAVPERLAVVGYDDVAMAGWEAFS
FT                   LTTIRQPMAQMARRAVQLLMERLRPGTSGEEPQREVFPPHLVKRETTAPPA"
     atggccgtca cgagtcggga catcgcacgt gagatcgggc tgtcgcagtc gaccgtctcg        60
     cgcgcgctgc ggggcgatcc gcgcgtcacc cccgcgacgc gcgaacgggt gcgcgaggcg       120
     gcggaacgac tccgctacgt ccccgacgcc gcggcgcgca cgctcacgac cggccgcacg       180
     cagatcgtcg gcgtcgtcgt cgccgacatc acgaacccgt tctatccgga gatcgtcgag       240
     gtcctccacg gcgagctggg gcaggagggc tacgcgaccg tgctgctcaa cgagccgcgc       300
     gccgacgacc tcgccggcca gctgcgcggc cgctccgtcg acgggctgat cgtcgtctcc       360
     gcgctgctcg acgagcagtt cgcgcgtcag ctctcgcggc tcgggatgcc ggtcgtgctg       420
     ctcaaccgcg acgtcgacga caccgccgtc gactgcgtcg tctccgacaa cgtcgccggc       480
     ggcgcgctcg ccgcagacca cctgctcgcg ctcggccacc gccgcatcgg cctcgtcgcc       540
     ggccccgcca acacctcgac ggcgcgcgat cgcgagcgcg gcatgcgcca agcgctcgcg       600
     cagcacggcg tcccgctcga cgacagcctc cgccgcagcg gctcgttctc gcaccactcc       660
     ggccatcagg gctgcctcga gctgctgcgc ctgccgcagc cgccgaccgc gctcgtctgc       720
     gcgagcgacg tcgtcgcctt cggggcgctc gacgccgcga agcggctcgg cgtcgcggtt       780
     cccgagcgcc tcgcggtcgt cggctacgac gacgtcgcga tggccggatg ggaggccttc       840
     tcgctgacga cgatccgcca gccgatggcg cagatggcgc ggcgtgcggt gcagctgctg       900
     atggagcggc tgcggccggg cacgagcggc gaggagccgc agcgcgaggt cttcccgccg       960
     cacctcgtca agcgcgagac gaccgcgccg cctgcctga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page