(data stored in ACNUC7421 zone)

EMBL: CP001854.PE13

CP001854.PE13        Location/Qualifiers
FT   CDS_pept        16003..16515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0013"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: scl:sce7616 adenylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48449"
FT                   /db_xref="GOA:D3EYP5"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP5"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB48449.1"
FT                   /translation="MTLEPASVALKLGFLAVLYLFLLWIVRSSLKDLRRAQAGGDAAVA
FT                   EMHAAAPAADATAMHNAADDLLGDAIGDGEPRLVVERAAGHPDGIAYDLARGVTLGRGD
FT                   VEIRLEDPFASSHHARIERQGSVLVLEDLGSTNGTYLNEEPLRGIQPLHHGDRIRIGDS
FT                   EFSYLQD"
     atgacgctcg aaccagcctc cgtcgcgctc aagctgggct ttctcgcggt cctctacctg        60
     ttcctgctgt ggatcgtgcg cagctcgctg aaggacctgc ggcgcgcgca ggccggcgga       120
     gacgcggcgg tcgcggagat gcacgcggcc gctcccgcgg ccgacgcgac cgcgatgcac       180
     aacgccgccg acgacctgct cggcgacgcg atcggggacg gcgagccgcg cctcgtggtc       240
     gagcgcgcgg cggggcatcc ggacgggatc gcctacgatc tggcacgcgg cgtcacgctc       300
     ggccgcggcg acgtcgagat caggctcgag gatccgttcg cctccagcca ccacgcgcgg       360
     atcgaacggc agggcagcgt gctggtgctc gaggacctcg gctcgaccaa cggcacctac       420
     ctcaacgagg agccgttgcg cgggatccag ccgctgcacc acggcgaccg gatccggatc       480
     ggcgacagcg agttctcgta ccttcaggac tga                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page