(data stored in ACNUC7421 zone)

EMBL: CP001854.PE130

CP001854.PE130       Location/Qualifiers
FT   CDS_pept        131473..133101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0130"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   Twin-arginine translocation pathway, signal sequence,
FT                   subgroup; KEGG: mes:Meso_0074 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48566"
FT                   /db_xref="GOA:D3F4Y8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y8"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADB48566.1"
FT                   /translation="MRDLRPSRRELLQGGGAAVGLLGLGGVLSACGGGESTSRAGSSQA
FT                   AATGERGGEITWGLAADPVFMVPFGATLGATREATEPIYESLLTWDRDLRIVPALAASY
FT                   SSPDDTTYEFVLRDGARFHDGRPVRASDVVYSIGLQRRPPPPGTPDMAVHVPAIKDVVA
FT                   VDERTVRISMDGPDARLPGFLAWGRHSSIVPEGMYDDIDPRTEANGTGPFRLVGYKQND
FT                   RVTFEANRDYWQSSMPGVDRMTLRVMTDEQGRLAALRAGDIDGCSVSPDLSEVLAADPN
FT                   VEVLKGLVAAHRELQFTIKTGERKPWHDKRVRQAINHAIDRQDLIERVYAGSAEFSGVV
FT                   PPGYGDWPLADEELRSDLLAHDPERARALLAAAGFGDGFTIELEVASTTTDLVKTAEIL
FT                   QQQLADVGVELKIRPIELAAFAKNNGEGRFDLHLTYRGMRGDVAGYVSDFDPSQPLYRD
FT                   VWFPGATDVDPELGRLIRQGATTIAEADRRPIYEQVQRLALAEALHVPLCNPYKFQAVS
FT                   KRVSGMYVAYTDFNPGLATARVTAS"
     atgcgagacc tgcggcccag ccgacgggag ctgctgcaag gaggcggggc ggcggtcggc        60
     ctcctcggcc tcggcggagt cctctccgcg tgcggtggag gcgagtcgac gagcagagcg       120
     ggatcgagcc aggccgccgc gaccggcgag cgcggcggcg agatcacctg gggcctcgcc       180
     gccgatcccg tcttcatggt cccgttcggt gcgacgctcg gcgcgacgcg cgaggcgacc       240
     gagccgatct acgagtcgct gctgacgtgg gaccgcgacc tcagaatcgt gccggcgctc       300
     gccgcgtcct acagctcgcc ggacgacacg acgtacgagt tcgtcctgcg cgacggcgcg       360
     agattccacg acggcagacc ggtccgtgcg agcgacgtcg tgtactcgat cggcctccag       420
     cgcagaccgc cgccgcccgg cacgcccgac atggccgtgc acgtgccggc gatcaaggac       480
     gtcgtcgccg tcgacgagag aacggtccgc atcagcatgg acgggccgga cgcgcgcctg       540
     cccggcttcc tcgcctgggg ccgtcactcc tcgatcgtgc cggaggggat gtacgacgac       600
     atcgacccgc gcaccgaggc gaacgggacc gggccgttca gactcgtcgg ctacaagcag       660
     aacgaccgcg tcacgttcga ggccaacagg gactactggc agtcctcgat gcccggcgtc       720
     gacagaatga cgctgcgcgt gatgaccgac gagcagggtc gcctcgccgc gctgcgcgcc       780
     ggcgatatcg acggctgctc ggtctcgccc gacctctccg aggtgctcgc cgccgatccg       840
     aacgtcgagg tgctgaaggg cctcgtcgcc gcgcaccgcg agctgcagtt cacgatcaag       900
     accggcgaga gaaagccgtg gcacgacaag cgcgtgcgac aggcgatcaa ccacgcgatc       960
     gaccgccagg acctgatcga gcgcgtctac gccggcagcg ccgagttctc cggcgtcgtc      1020
     ccgcccggct acggcgactg gccgctcgcc gacgaggagc tgcgcagcga tctgctcgcg      1080
     cacgaccccg agagagcgag agcgctgctc gctgccgccg gcttcggcga cggcttcacg      1140
     atcgagctgg aggtcgcctc gacgacgacc gacctcgtca agaccgccga gatcctgcag      1200
     cagcagctcg cggacgtcgg cgtcgagctg aagatccggc cgatcgagct ggccgccttc      1260
     gcgaagaaca acggcgaggg cagattcgac ctccacctca cctaccgcgg gatgcgcggt      1320
     gacgtcgccg gctacgtcag cgacttcgat ccctcgcagc cgctgtacag agacgtctgg      1380
     ttccccggcg cgaccgacgt cgaccccgag ctcggcaggc tgatcagaca gggcgcgacg      1440
     acgatcgccg aggccgaccg gcggccgatc tacgagcagg tccagcggct cgcgctggcc      1500
     gaggcgctgc acgtcccgct ctgcaacccc tacaagttcc aggccgtctc caagcgcgtc      1560
     tccgggatgt acgtcgccta caccgacttc aaccccggac tggcgaccgc ccgcgtgacc      1620
     gcgagctga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page