(data stored in ACNUC7421 zone)

EMBL: CP001854.PE131

CP001854.PE131       Location/Qualifiers
FT   CDS_pept        133103..134053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0131"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbt:BBta_2849 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48567"
FT                   /db_xref="GOA:D3F4Y9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48567.1"
FT                   /translation="MARYLASRVAQLGLTLLGVSVVIFLLVRLLPGDVLDASSGDTVAG
FT                   SSEGRDALREALGLADPLPVQYFDWIKGLVTGDLGVSLRSGEPLANLLSTALPMTLEIV
FT                   LLGVAIALLVGIPLGVLSAVRSGRAIDYVGRAIGMIGVSLPSFWLATLMLLVTSSAFGW
FT                   VPSSTYISPFEDPLGNLAALILPALCISVYMLALVMRMVRATMLEVLGEDYVRTARAKG
FT                   AAPRTVVVRHALRNALLPVITVSAFEVGVLLASTALIEVVFGLPGLGNLLVQGIFNRDY
FT                   AVIQTVTLLLAATFVLMNLIADVLYALVDPRVELR"
     gtggcgcgct acctcgccag ccgcgtcgcg cagctggggc tcacgctcct cggcgtctcg        60
     gtcgtgatct tcctgctcgt gcggctgctg ccgggcgacg tgctcgacgc cagctcgggc       120
     gacaccgtcg cggggtcgag cgaggggcgc gacgcgctgc gcgaggcgct cggtctcgcc       180
     gacccgctgc cggtccagta cttcgactgg atcaagggcc tcgtcaccgg cgacctcggc       240
     gtctcgctgc gcagcggcga gccgctcgcc aacctgctct cgaccgcgct gccgatgacg       300
     ctcgagatcg tcctgctcgg cgtcgcgata gcgctgctgg tcgggatccc gctcggcgtc       360
     ctgtccgccg tccgctcggg cagagcgatc gactacgtgg gccgcgcgat cggcatgatc       420
     ggcgtctcgc tgccgagctt ctggctcgcg acgctgatgc tgctggtcac ctcctcggcg       480
     ttcggctggg tgccgtcgag cacgtacatc agcccgttcg aggatccgct cgggaacctc       540
     gccgcgctga tcctgccggc gctctgcatc tcggtctaca tgctcgcgct cgtgatgcgg       600
     atggtgcgcg cgacgatgct cgaggtgctc ggcgaggact atgtgcggac cgcccgcgcg       660
     aagggcgccg cgccgcgcac cgtcgtcgtg cgacatgcgc tgcgcaacgc gctgctgccg       720
     gtcatcaccg tctcggcgtt cgaggtcggc gtgctgctcg cgagcaccgc gctgatcgag       780
     gtcgtgttcg ggctgccggg cctcggcaac ctgctcgtgc aggggatctt caaccgcgat       840
     tacgccgtga tccagacggt cacgctgctg ttggcggcga cgttcgtgct gatgaacctg       900
     atcgccgacg tgctctacgc gctggtcgac ccgcgggtgg agctgcgatg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page