(data stored in ACNUC7421 zone)

EMBL: CP001854.PE132

CP001854.PE132       Location/Qualifiers
FT   CDS_pept        134050..134952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0132"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbr:BB2519 ABC transporter
FT                   inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48568"
FT                   /db_xref="GOA:D3F4Z0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48568.1"
FT                   /translation="MSAPATVATAAEVEVGATGASARRRVRLSPMLRTPIAIAGLSIVL
FT                   LTVFVAVAGPWIWTTDPYAADAARLQPPSWAHPMGTDELGRDTLARVIYGARVSLEVGL
FT                   SAVGVAALLGSLIGLVAAFYGRWVDTALMRFVDVLFALPALVLAIVVAGLLGPSRTNAM
FT                   LAIGIAYAPAFARVVRSAALSVMTQPYIEAARALGTSSATTIRRHLLPNVMAPLVVMAS
FT                   TYLGTAILAEASLSFLGLGTQPPQPSWGGMLSSARTYMLVSPWVAIFPGLAIMVVVLGV
FT                   NLLGDALRDGLDPKLRGRR"
     atgagcgcgc ccgccaccgt cgccaccgcc gccgaggtcg aggtcggcgc gaccggcgcg        60
     agcgcccgcc ggcgcgtccg gctctcgccg atgctgcgca ccccgatcgc gatcgctggc       120
     ctgtcgatcg tgctgctgac cgtgttcgtc gcggtcgccg gaccgtggat ctggacgacc       180
     gatccgtacg ccgccgacgc cgcccgtctg cagccgccgt cgtgggccca tccgatgggc       240
     accgacgagc tcggccgcga cacgctcgcg cgcgtcatct acggcgcccg cgtctcgctc       300
     gaggtcggcc tctcggccgt cggcgtcgcg gcgctgctgg gctcgctgat cggcctggtc       360
     gccgccttct acggacgctg ggtcgacacc gcgctgatgc gcttcgtcga cgtcctcttc       420
     gcgctccccg cgctcgtcct cgcgatcgtc gtcgccggcc tgctcggccc cagccgcacg       480
     aacgcgatgc tggcgatcgg gatcgcctac gcgccggcgt tcgcgcgcgt cgtccgctcg       540
     gccgcgctgt cggtcatgac gcagccgtac atcgaggccg cgagagcgct cggcacatcc       600
     agcgcgacga cgatccgccg ccacctgctg ccgaacgtga tggcgcccct cgtcgtgatg       660
     gcgagcacct acctggggac ggcgatcctc gcggaggcgt cgctgagctt cctcgggctc       720
     ggcacccagc cgccgcagcc gtcgtggggc gggatgctca gctcggcgcg cacgtacatg       780
     ctcgtctccc cctgggtggc gatcttcccc ggcctcgcga tcatggtcgt cgtcctcggg       840
     gtcaacctcc tcggcgacgc gctgcgcgac ggcctcgacc cgaagctgcg agggcggaga       900
     tga                                                                     903
//

If you have problems or comments...

PBIL Back to PBIL home page