(data stored in ACNUC7421 zone)

EMBL: CP001854.PE133

CP001854.PE133       Location/Qualifiers
FT   CDS_pept        134949..135935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0133"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48569"
FT                   /db_xref="GOA:D3F4Z1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z1"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB48569.1"
FT                   /translation="MTDGTLLTVERLDVRFRTAGGWTQVVDGVDLTVGAGETLCVVGES
FT                   GSGKSVTALALMGLLDAGAARVEGRIDFGGRDLAALSERDWQRVRGNDVAMIFQEPMSS
FT                   LNPVLRIGDQIAESVLLHSDADKAAADRRAVELLRLVGIPAPERRARDYPHQLSGGMRQ
FT                   RVMIAIALSCSPRLLIADEPTTALDVTIQAQILELIGELRERLEMAVLLITHDLGVVAE
FT                   TADRVAVMYAGKIVEQGDVKAVFEDPQHPYTAALLRAIPVLGSTYAEPLYAIPGTVPSP
FT                   GGWPDGCRFAARCEHVHAACAQDPPAFARGSHFARCWLRDPDAEERR"
     atgacggacg gaacgctgct gaccgtcgag cggctcgacg tgcgcttccg caccgccggc        60
     ggctggacgc aggtcgtcga cggcgtcgac ctgaccgtcg gcgccggcga gacgctgtgc       120
     gtcgtcggcg agtcgggctc cggcaagagc gtcaccgcgc tcgcgctgat gggcctgctc       180
     gacgcgggcg ccgcgcgcgt cgagggccgg atcgacttcg gcggccgcga cctcgccgcg       240
     ctctccgagc gcgactggca gcgcgtccgc ggcaacgacg tcgcgatgat cttccaggag       300
     ccgatgagct cgctgaaccc ggtgctgcgg atcggcgacc agatcgccga gtcggtgctg       360
     ctgcactccg acgcggacaa ggccgccgcc gaccgccgcg ccgtcgagct gctgaggctc       420
     gtcgggatcc cggcgccgga gcggcgcgcg cgcgactatc cccaccagct gtccggcggg       480
     atgcgccagc gcgtgatgat cgcgatcgcg ctgagctgca gtccgcggct gctgatcgcc       540
     gacgagccga cgaccgcgct cgacgtgacg atccaggcgc agatcctgga gctgatcggc       600
     gagctgcgcg agcggctgga gatggcggtg ctgctgatca cccacgacct cggcgtcgtc       660
     gccgagacgg ccgatcgcgt cgccgtcatg tacgccggca agatcgtcga gcagggcgac       720
     gtcaaggccg tcttcgagga tccgcagcac ccgtacaccg ccgcgctgct gcgggcgatc       780
     ccggtgctcg gctcgacgta cgccgagccg ctctacgcga tccccgggac ggtcccgagc       840
     cccggcggct ggccggacgg ctgccgcttc gccgcccgct gcgagcacgt ccacgccgcg       900
     tgcgcgcagg acccgcccgc gttcgcgcgc ggctcccact tcgcgcgctg ctggctgcgc       960
     gaccccgacg ccgaggagcg cagatga                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page