(data stored in ACNUC7421 zone)

EMBL: CP001854.PE134

CP001854.PE134       Location/Qualifiers
FT   CDS_pept        135932..136939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0134"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48570"
FT                   /db_xref="GOA:D3F4Z2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z2"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB48570.1"
FT                   /translation="MSDVLVRARDLRVHFPLGGGVLSRSSAQVRAVDGVELEIRRGETL
FT                   GLVGESGCGKSTLGRALVRLVRPTGGSVEFDGTDVARLPRRGRGRGDGSGRDGRGALAR
FT                   EMQIVFQDPVGSLNPRMKVGAIVAEGLASNRIGTRASRRELVVEMLERVGLGSDAVDRY
FT                   PHEFSGGQRQRIVIARALAVGARFVVADEPVSALDVSVQSQVLNLFVRLKRELDLTYVF
FT                   VAHDLAVVGYVSDRIAVMYLGKIVELGPAQALISAPRHPYTRALLSAVPQARVGARRER
FT                   TALTGDVPNPIDPPSGCRFRTRCPMAAAICAEQEPPLRTHGDGHLAACHFAEAV"
     atgagcgacg tcctggtccg tgcccgcgac ctgcgggtgc acttcccgct cggcggcggc        60
     gtgctgtcgc gctcctcggc gcaggtgcgc gcggtcgacg gcgtcgagct ggagatccgc       120
     cgcggcgaga cgctcggact cgtcggcgag tccggctgcg gcaagtcgac gctcggtcgt       180
     gcgctcgtgc ggctggtgag accgaccggc ggcagcgtcg agttcgacgg caccgacgtc       240
     gcgcggctgc cgcgtcgtgg ccgcgggcgc ggcgacggca gcggccgcga cgggcgcggt       300
     gcgctcgcgc gcgagatgca gatcgtcttc caggatccgg tcggctcgct caacccgcgc       360
     atgaaggtcg gcgcgatcgt cgccgaggga ttggcgagca accgcatcgg gacgcgcgcc       420
     tcgcgccgcg agctggtcgt cgagatgctg gagcgggtcg gcctcggcag cgacgccgtc       480
     gaccgctatc cgcacgagtt ctccggcggc cagcggcagc ggatcgtgat cgcccgcgca       540
     ctggcggtcg gcgcgcgctt cgtcgtcgcg gacgagccgg tctcggcgct cgacgtctcg       600
     gtccagtcgc aggtgctgaa cctgttcgtc cggctcaagc gcgagctgga cctgacgtac       660
     gtcttcgtcg cgcacgacct cgccgtcgtc ggctacgtca gcgatcggat cgcggtgatg       720
     tacctcggca agatcgtcga gctggggccg gcgcaggcgc tgatctccgc tccccgccac       780
     ccctacacgc gggcactgct gtcggcggtg ccgcaggcgc gcgtcggcgc ccgccgcgaa       840
     cgcaccgcgc tgaccggcga cgtcccgaac ccgatcgacc cgccgtccgg ctgccgcttt       900
     cgcacccgct gcccgatggc ggcggcgatc tgcgccgagc aggagccgcc gctgcggacc       960
     cacggcgacg gccacctcgc cgcctgtcac ttcgccgagg ccgtctag                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page