(data stored in ACNUC7421 zone)

EMBL: CP001854.PE135

CP001854.PE135       Location/Qualifiers
FT   CDS_pept        complement(136944..137564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0135"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: asa:ASA_3469 protein-L-isoaspartate O-
FT                   methyltransferase; TIGRFAM: protein-L-isoaspartate O-
FT                   methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O- methyltransferase;
FT                   Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48571"
FT                   /db_xref="GOA:D3F4Z3"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z3"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADB48571.1"
FT                   /translation="MDPAAELARSLRSVVADARVLAAIAAVPRELFVPEALRERAYDNV
FT                   ALPIGQGQTISQPLVVARMLEVLDLGPDDDVLDVGTGSGYHAALLARLVRHVWTIERHR
FT                   RLSAAAEGNLRAAGVENVTVLVGDGSRGLDEQAPFDAINVAAAAWPQVPAALERQLARG
FT                   GRLVAPVGASGQQLVLVERGADGELRRTALEAVRFVPLIEGEP"
     atggatccgg cagccgagct ggcgcgatcg ctgcgcagcg tcgtcgccga cgcgcgcgtg        60
     ctcgccgcga tcgcggcggt gccgcgcgag ctgttcgtgc ccgaggcgct gcgcgagcgc       120
     gcctacgaca acgtcgcgct gccgatcggc caggggcaga cgatctctca gccgctcgtc       180
     gtcgcgcgga tgctggaggt gctcgacctc ggaccagacg acgacgtgct cgacgtcggc       240
     accggctccg ggtaccacgc ggcgctgctg gcccggctcg tgcggcacgt ctggacgatc       300
     gagcggcacc gccggctgag cgccgccgcg gagggcaacc tgcgcgcggc gggcgtcgag       360
     aacgtgaccg tgctcgtcgg cgacggctcg cgcgggctcg acgagcaggc gccgttcgac       420
     gcgatcaacg tcgcggcggc ggcgtggccg caggtgccgg cggcgctcga acgccagctc       480
     gcacgcggcg gccggctcgt cgcgccggtc ggcgcgagcg gccagcagct cgtgctggtg       540
     gagcgcggcg ccgacggcga gctgcgccgc acggcgctgg aagcggtccg cttcgtgccg       600
     ctgatcgagg gcgagcccta g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page