(data stored in ACNUC7421 zone)

EMBL: CP001854.PE136

CP001854.PE136       Location/Qualifiers
FT   CDS_pept        137611..138561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0136"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   pol:Bpro_1976 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48572"
FT                   /db_xref="GOA:D3F4Z4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z4"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADB48572.1"
FT                   /translation="MSGVPPNIVRRRVMALLVLVAALAVVVALVVTVAGGGDDDPASAR
FT                   ADAGAAAKTTGARARGDGGRAGGGSAAGAAASPTAGRDMGRPGPPRPVPILMYHVTTDP
FT                   PANAPFPDLYVRASEFADQMQALKQAGYVAVTQQELWDAWHRGGPLPARAVVVSIDDGY
FT                   RSNYLNARPVLRRLGWPAVLNLKVGNLSEPEYGLTDGQVKELIADGWEIDSHTIDHPDL
FT                   TTVDAATLAREVAESRAELQRRFGVPVNFFCYPAGRYDDTVIAAVERAGYLAATTVEPG
FT                   LAQPDAGSPFALNRVRVNSGVSGASLVSQLADLGA"
     atgtcagggg tcccgccgaa catcgtgcgc cggcgcgtca tggcgctgct cgtgctcgtc        60
     gccgcgctgg cggtcgtcgt cgcgctcgtc gtcacggtcg ccggcggcgg tgatgacgat       120
     ccggcgtccg cgcgcgcaga cgccggcgcc gcggcgaaga cgaccggcgc cagagcgcgc       180
     ggcgacggcg gcagagcagg cggcgggagc gccgcgggcg ccgccgcctc cccgaccgcc       240
     gggcgcgaca tgggcagacc ggggccgccg cgcccggtcc cgatcctgat gtaccacgtc       300
     acgaccgacc cgcccgcgaa cgcgccgttc cccgacctct acgtcagagc gtccgagttc       360
     gccgaccaga tgcaggcgct gaagcaggcg ggctacgtcg ccgtcacgca gcaggagctg       420
     tgggacgcgt ggcacagagg cggaccgctg ccggccagag cggtcgtcgt ctcgatcgac       480
     gacggctacc gctccaacta cctcaacgcc cgcccggtgc tgagaagact cggctggccg       540
     gcggtcctca acctcaaggt cggcaacctc tccgagcccg agtacggcct caccgacggg       600
     caggtgaagg agctgatcgc cgacggctgg gagatcgact cccacacgat cgaccacccc       660
     gacctgacga ccgtcgacgc ggcgacgctc gcacgcgagg tcgcggagtc gcgcgccgag       720
     ctgcagcgcc gcttcggcgt cccggtcaac ttcttctgct accccgccgg cagatacgac       780
     gacacggtga tcgcagccgt cgagagagcg ggctacctcg ccgccacgac ggtcgagccc       840
     gggctcgcgc agccggacgc cggctcgccg ttcgcgctca accgcgtgcg cgtcaacagc       900
     ggcgtctcgg gcgcctcgct cgtctcgcag ctcgccgacc tcggcgcgta g                951
//

If you have problems or comments...

PBIL Back to PBIL home page