(data stored in ACNUC7421 zone)

EMBL: CP001854.PE137

CP001854.PE137       Location/Qualifiers
FT   CDS_pept        complement(138565..140856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0137"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: har:HEAR0629 putative signal peptide; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; PAC
FT                   repeat-containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48573"
FT                   /db_xref="GOA:D3F4Z5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB48573.1"
FT                   /translation="MASSAPVAGGHARDAVRRALAWFPSGRSLPDAVWERRHRGLLILL
FT                   WAHVPALFVFALATGNPLQHALLEVVPIALCALVGQREQLGRRGRAAAVTIGLLTCSAV
FT                   LVHLWDGTIEAHFHYFVMVVALAAYEEWFPYLLAFGYVVLQHGLMGMMEPDSVYAHGTD
FT                   DDRSPWFWAAIHGGFIAALGFASMVTWRANESVRAHLAASEQRFHRAFDDAPIGMALIG
FT                   LDGRFREVNRSLASLTGYGAGKLVQLRLWDLSPADVRAEDHAAWPPSAGMEAVEQRFQR
FT                   ADGTIGWGLWRYSLVQDESGIASHWVVQLLDVTSRKQFEQQLAHQAHHDPLTGLPNRAL
FT                   LTKRLQEALDLAREHDSGVAVIFVDLDNFKVINDSLGHDAGDRLLRNVSERLRRVLRPE
FT                   DLLARFGGDELAVCLERVADTEPANRIADRMATALRAPFVLDGEQRFVTASFGIALARP
FT                   EDPDRSPDTLLRDADAAMYRAKERGKARTEIFDASMRRRAVDRLELESGLREALARNQL
FT                   RVVYQPEVSLESGRIVAVEALLRWEHPQHGPISPARFIPIAEQSGLIVPIGAWVLREAC
FT                   RQAAHWNAESGGDGVVVAVNLSVRQLGASDLEATVRGAIDGARLPADRLCLEITESAVM
FT                   ADPAAAIESLQTLKRVGVKLAIDDFGVGYSSLSHLRELLPIDVLKIDRSFIDGVVLREE
FT                   DRAIVTAIVQLARSLGVDAVAEGVETSDQAAALRAMHCPIAQGFHFARPQPPADVAQLL
FT                   GVHALGELLG"
     atggcttcgt cggcgccggt cgccggcgga cacgcgcgcg acgcggtccg ccgggcgctc        60
     gcttggttcc ccagcggccg ctcgctgccc gacgccgtct gggagcgtcg ccatcgcggc       120
     ctgctgatcc tgctgtgggc gcacgtgccc gcgctgttcg tgttcgcgct cgccaccggc       180
     aacccgctgc agcacgcgct gctggaggtc gtcccgatcg ccctctgcgc gctggtcggg       240
     cagcgcgagc agctcggccg gcgggggcgt gccgcggccg tcacgatagg gctgctgacc       300
     tgctcggccg tgctcgtgca cctgtgggac ggcacgatcg aggcgcactt ccactacttc       360
     gtgatggtcg tcgcgctggc cgcctacgag gagtggttcc cgtacctgct ggcgttcggc       420
     tacgtcgtcc tgcagcacgg cctgatgggg atgatggagc ccgactccgt ctacgcgcac       480
     gggaccgacg acgaccgcag cccgtggttc tgggccgcga tccacggtgg cttcatcgcc       540
     gcgctcggct tcgccagcat ggtgacgtgg cgtgcgaacg aatccgtccg cgcgcacctc       600
     gccgccagcg agcagcgctt ccaccgcgcc ttcgacgacg cgccgatcgg catggcgctg       660
     atcggcctcg acggccgctt ccgcgaggtc aaccgctcgc tcgcgagcct gaccggctac       720
     ggcgcgggga agctcgtgca gctgcggctg tgggacctca gccccgccga cgtgcgcgcc       780
     gaggaccatg ccgcgtggcc gccgagcgcc ggcatggagg ccgtcgagca gcgcttccag       840
     cgcgccgacg ggacgatcgg ctggggcctg tggcgctact cgctcgtgca ggacgagagc       900
     gggatcgcat cgcactgggt cgtgcagctg ctcgacgtca cgtcgcgcaa gcagttcgag       960
     cagcagctcg cccaccaggc ccaccacgac ccgctgaccg gcctgccgaa tcgcgcgctg      1020
     ctgaccaagc ggctgcagga ggcgctcgac ctcgcccgcg agcacgacag cggcgtcgcg      1080
     gtgatcttcg tcgacctcga caacttcaag gtcatcaacg actcgctcgg acacgacgcc      1140
     ggcgaccggc tgctgcgcaa cgtctccgag cggctgcggc gcgtgctgcg ccccgaggac      1200
     ctgctcgccc gcttcggcgg cgacgagctg gccgtctgcc tcgagcgcgt cgccgacacc      1260
     gagccggcga accgtatcgc cgaccggatg gcgaccgcgc tgcgggcgcc gttcgtgctc      1320
     gacggcgagc agcggttcgt gaccgccagc ttcggcatcg cgctcgcgcg acccgaggat      1380
     cccgaccgct cgcccgacac gctgctgcgc gacgccgacg cggcgatgta ccgcgcgaag      1440
     gagcgcggca aggcccgcac ggagatcttc gacgcgtcga tgcgccggcg cgcggtcgac      1500
     cggctggagc tggagagcgg cctgcgggag gcgctcgcgc gcaaccagct gcgcgtcgtc      1560
     taccagcccg aggtctcgct cgagagcggc cggatcgtcg cggtcgaggc gctgctgcgg      1620
     tgggagcacc cgcagcacgg tccgatctcg ccggcgcgct tcatcccgat cgccgagcag      1680
     agcggcctga tcgtcccgat cggcgcgtgg gtgctgcgcg aggcgtgccg gcaggccgcg      1740
     cactggaacg ccgagagcgg cggcgacggc gtcgtcgtcg cggtcaacct gtcggtccgc      1800
     cagctcggcg cctcagatct ggaggcgacg gtgcgcgggg cgatcgacgg cgcgcgcctg      1860
     cccgccgacc ggctctgcct ggagatcacc gagagcgcgg tgatggccga tccagcagcg      1920
     gcgatcgagt cgctgcagac gctcaagcgg gtcggcgtga agctcgcgat cgacgacttc      1980
     ggcgtcggct actcgtcgct cagccacctg cgcgagctgc tgccgatcga cgtgttgaag      2040
     atcgacagat cgttcatcga tggggtcgtc ctgcgcgagg aggaccgcgc gatcgtgacg      2100
     gcgatcgtcc agctcgcgcg atcgctcggc gtcgacgccg tcgcggaggg cgtcgagacg      2160
     tccgaccagg cggcggcgct gcgggcgatg cactgcccga tcgcgcaggg cttccacttc      2220
     gcgagaccgc agccgccggc cgacgtcgcc cagctgctcg gcgtgcacgc gctcggcgag      2280
     ctgctcggct ga                                                          2292
//

If you have problems or comments...

PBIL Back to PBIL home page