(data stored in ACNUC7421 zone)

EMBL: CP001854.PE138

CP001854.PE138       Location/Qualifiers
FT   CDS_pept        complement(140919..141272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48574"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z6"
FT                   /inference="similar to AA sequence:KEGG:MXAN_6481"
FT                   /protein_id="ADB48574.1"
FT                   /translation="MPIRRLFGPFFVVAGILHFVKPRIYEAIMPDWLPAHRELVYASGV
FT                   AEIAAGAALLHPRTRRLGGLLSVATLVAVFPANVHMCLHAERYRLPGGRAGLIARLPLQ
FT                   GLLIAWARAAARG"
     atgccgattc gacgcctgtt cggtcccttc ttcgtcgtcg cggggatcct ccacttcgtc        60
     aagccgcgga tctacgaggc gatcatgccg gactggctgc cggcccaccg cgagctggtc       120
     tacgccagcg gcgtcgccga gatcgcggcc ggcgccgcgc tgctgcaccc gcgcacccgc       180
     cgcctcggcg gactgctgag cgtcgcgacg ctcgtcgcgg tcttcccggc gaacgtgcac       240
     atgtgcttgc acgcggagcg ctacagactg cccggcggcc gcgcggggct gatcgcgcgc       300
     ctgccgttgc agggactgct gatcgcatgg gcgcgcgccg ccgcgcgcgg gtga             354
//

If you have problems or comments...

PBIL Back to PBIL home page