(data stored in ACNUC7421 zone)

EMBL: CP001854.PE139

CP001854.PE139       Location/Qualifiers
FT   CDS_pept        complement(141282..142463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48575"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48575.1"
FT                   /translation="MAARSRRGTRLEPVAELTWDQVLGLRLQRQRLDVRAPHAERLVVA
FT                   GALCGLHAQLMSSAELTLWARVEQLRSDDVATALWEERALVKTWAARGTLHLLPSADYG
FT                   SWTGALTARAPRAYLNASRLRYFGLTEEELLRIAAEIDATLADGRLLTRTELAAEVQRR
FT                   TGSQALGDRLRDNWGSTLKYPAAVGALCFGPSDGQNVRFAHPAAWLGAWRADDGEAALA
FT                   DAARRWLAVAGPLTREELARWWGVAPADGRRMLRLLGDEVVPVTVEGTERWLLAADVEP
FT                   AQRSAAKGSGGVRLLPGFDQYTIAATLHADQLLPAGARARVYRPQGWISPVLLVEGRMA
FT                   GVWRHERRGTALRVGIEPFGRLPRAARAAAASEVELLARFLGGEAALDWGPLG"
     atggccgcca gatcacgcag gggaacgaga ctggagcccg tcgccgagct gacctgggac        60
     caggtcctgg gactgcggct ccagcgccag cgactcgacg tccgcgcccc gcacgccgag       120
     cggctcgtgg tcgccggggc gctctgcggc ctgcacgctc agctgatgtc gagcgccgag       180
     ctgacgctgt gggcgcgcgt cgagcagctc cgttccgacg acgtcgccac ggcgttgtgg       240
     gaggagcgtg cgctcgtgaa gacgtgggcg gcgcgcggca cgctccacct gctgccgagc       300
     gccgactacg gcagctggac gggcgcgctg accgcgcgcg ctccgcgtgc ctacctcaac       360
     gccagccgcc tgcgctactt cggcctgacc gaggaggagc tgctgcggat cgccgccgag       420
     atcgacgcga cgctcgccga cggccggctg ctgacgcgca cggagctggc cgcggaggtg       480
     cagcggcgca ccggctcgca ggcgctcggt gaccggctgc gcgacaactg gggctcgacg       540
     ctcaagtacc cggccgccgt cggcgccctc tgcttcggtc cgagcgacgg ccagaacgtg       600
     cgcttcgcgc atcccgccgc gtggctggga gcgtggaggg cggacgacgg cgaggcggcg       660
     ctcgcggacg ccgcgcgccg ctggctcgcc gtcgccgggc cgttgacgcg cgaggagctg       720
     gcgcgctggt ggggcgtcgc gccggcagac ggaagacgga tgctgcggct gctcggcgac       780
     gaggtcgtgc cggtcaccgt cgaggggacc gagcgctggc tgctcgccgc cgacgtcgag       840
     ccggcacagc ggtcggcggc gaaggggagc ggcggcgtgc ggctgctgcc cggcttcgac       900
     cagtacacga tcgccgcgac gctccacgcc gaccagctgc tgccggccgg cgcgagagcg       960
     cgcgtctacc ggccgcaggg atggatctcg ccagtgctgc tcgtcgaggg acggatggcc      1020
     ggcgtctgga gacacgagcg cagaggcacg gcgctgcgcg tcgggatcga gccgttcggc      1080
     agactgccgc gcgcggcaag agcggcggcc gcgagcgagg tggagctgct cgcgcggttc      1140
     ctcggcggcg aggcggcgct cgactggggg ccgctgggct ag                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page