(data stored in ACNUC7421 zone)

EMBL: CP001854.PE14

CP001854.PE14        Location/Qualifiers
FT   CDS_pept        16543..17793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0014"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: ank:AnaeK_3749 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48450"
FT                   /db_xref="GOA:D3EYP6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP6"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADB48450.1"
FT                   /translation="MLRVAEHVEKSDTGLARRANEDNFFVRSPLFVVADGMGGAQAGEV
FT                   ASRLAAETFATGLPEGGTVEERLATRVLEANSRIYRLSREDSERAGMGTTLTAIYVDGE
FT                   ELAVAHVGDSRAYLWRDGELTRLTRDHSLVDELVRRGKLTEEEAAEHPQRSIITRALGP
FT                   EPDVEVDTRTYRAQAADVLLLCSDGLTSMISEQHVAELLGAAESLEAAAQALIDAANAA
FT                   GGRDNITVVLFRLEEAAAGAAAEASATAPLDQPTQTGMRAADARTAVAPAEPETAEQPA
FT                   ARAAAREQPPELPAVVAARRRRAERENQPLPRRVKIFAATVSTLIVLTILGIAGMFATR
FT                   AVFFVGTNDQGMVTVYKGLPFDLPAGLKLYSEYSVSGVPAAAVPEPRRKELLDHQLRSR
FT                   SDARDLVAQLELGRLSP"
     atgctgcgcg tcgcagagca cgtcgagaag tccgacaccg ggctcgcccg ccgcgcgaac        60
     gaggacaact tcttcgtccg ctcgccgctg ttcgtcgtcg ccgacgggat gggcggcgcg       120
     caggccggcg aggtcgcctc gcgactcgcc gccgagacgt tcgcgaccgg gctgccggag       180
     ggcggcaccg tcgaggagcg gctcgcgaca cgcgtgctgg aggccaactc gcgcatctac       240
     agactgtcgc gcgaggacag cgagcgcgcc ggcatgggca cgacgctgac ggcgatctac       300
     gtcgacggcg aggagctggc cgtcgcgcac gtcggcgaca gccgcgccta cctgtggcgc       360
     gacggcgagc tgacgcggct gacgcgcgac cactcgctcg tcgacgagct ggtcaggcgc       420
     gggaagctga ccgaggagga ggccgccgag catccgcagc ggtcgatcat cacgcgcgcg       480
     ctcgggcccg agccggatgt cgaggtcgac acccgcacct accgcgccca ggctgccgac       540
     gtgctgctgc tgtgcagcga cgggctgacc tcgatgatct ccgagcagca cgtcgccgag       600
     ctgctcggcg ccgccgaatc gctggaggcg gcggcgcagg cgctcatcga cgctgccaac       660
     gcggccggcg ggcgcgacaa catcaccgtc gtgctgttcc ggctggagga ggccgccgcc       720
     ggcgcggccg cggaggcgag cgcgaccgcg ccgctcgacc agccgacgca gaccggcatg       780
     cgggcggccg acgcgcgcac cgccgtcgcg ccggccgagc cggagacggc cgagcagccc       840
     gccgcgcgcg cagcggcgcg cgagcagccg ccggagcttc ccgcggtcgt cgccgcgcgc       900
     cgccgtcgcg ccgagcgcga gaaccagccg ctgccgcgcc gcgtgaagat cttcgcggcg       960
     accgtctcga cgctgatcgt gctgacgatc ctcgggatcg ccggcatgtt cgcgacgcgc      1020
     gcagtcttct tcgtcgggac caacgaccag gggatggtga ccgtctacaa ggggctgccg      1080
     ttcgacctgc cggcgggcct gaagctgtac tcggagtact ccgtctccgg tgtcccggcc      1140
     gccgccgtgc cggagccgcg ccgcaaggag ctgctcgacc accagctgcg ctcgcgcagc      1200
     gatgcgcgcg acctcgtcgc gcagctggag ctcggaagac tctcgccgtg a               1251
//

If you have problems or comments...

PBIL Back to PBIL home page