(data stored in ACNUC7421 zone)

EMBL: CP001854.PE140

CP001854.PE140       Location/Qualifiers
FT   CDS_pept        complement(142490..142891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0140"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   dde:Dde_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48576"
FT                   /db_xref="GOA:D3F4Z8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z8"
FT                   /inference="protein motif:PFAM:PF00472"
FT                   /protein_id="ADB48576.1"
FT                   /translation="MPITRDVALPLTEVTLRASRSSGPGGQHANVTASRIEAVFDVAAS
FT                   RTLQPWQKERVRARYGPRVTAVAQDARSQALNRELALERLRDRLAGALAVPRHRTPTKP
FT                   SKASRRRRVEAKKRRSEHKRGRQKPRHDD"
     atgccgatca cgcgcgacgt cgcgctcccg ctcacggagg tgacgctgcg cgccagccgc        60
     tcgtcggggc cgggcggcca acacgcgaac gtgaccgcct cgcggatcga ggcggtcttc       120
     gacgtcgccg cctcgcgcac gctgcagccg tggcagaagg agcgcgtccg cgcccgctac       180
     gggccgcgcg tgaccgccgt cgcgcaggac gcgcgcagcc aggcgctgaa ccgcgagctg       240
     gcgctcgagc gactgcgcga ccggctcgcc ggcgcgctcg cggtgccgcg ccaccgcacg       300
     ccgacgaaac cgtcgaaggc gtcgagaaga cgccgcgtcg aggcgaagaa gcgccgctcc       360
     gagcacaagc gcgggcggca gaagccgcgc cacgacgact ga                          402
//

If you have problems or comments...

PBIL Back to PBIL home page