(data stored in ACNUC7421 zone)

EMBL: CP001854.PE141

CP001854.PE141       Location/Qualifiers
FT   CDS_pept        142999..143268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48577"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48577.1"
FT                   /translation="MAKVLVTIEDPLLKRIDRTVRERGLTRSGYLSELARRDLDAQLGP
FT                   GADPQVRAALRRMQDLVAGLDVRSDEDTTSLLRRTRDERLDQLG"
     atggcaaagg tgctcgtgac gatcgaagac cccctcctca agcgcatcga tcgcacggtg        60
     cgcgagcgcg gcctgacgcg cagcggctac ctgtcggagc tggcgcgccg cgacctcgac       120
     gcccagctcg gccccggcgc cgaccctcag gtgagagcgg cgctgcggcg gatgcaggat       180
     ctcgtcgccg gcctcgacgt gcgaagcgac gaggacacga cgagcctgct gcgcagaacc       240
     cgcgacgagc gactggacca gctcgggtga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page