(data stored in ACNUC7421 zone)

EMBL: CP001854.PE142

CP001854.PE142       Location/Qualifiers
FT   CDS_pept        143265..143675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0142"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   sfu:Sfum_1407 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48578"
FT                   /db_xref="GOA:D3F500"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3F500"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADB48578.1"
FT                   /translation="MTEAVLDANVVLKWLRPEEEPREPAAAFLRAAHDAGELRVTAPAL
FT                   LPYEVLNVVGRKWRVDAAALIELATWFGALRFDLVEPPLAEVARWTAAGLSAYDAAYVA
FT                   VAEAAGIELITADAGIVAAAPGIARGLADAAG"
     gtgaccgagg cggtgctgga cgcgaacgtc gtgttgaagt ggctgcgccc ggaggaagag        60
     ccgcgtgaac ctgccgcggc cttcctgcgc gccgctcacg acgcgggcga gctgcgcgtg       120
     accgcgccgg cgctgctccc gtacgaggtg ctgaacgtcg tcgggcgcaa gtggcgggtc       180
     gacgcggcgg cgctgatcga gcttgcgacg tggttcggcg cgctgcgctt cgacctcgtc       240
     gagccgccgc tcgccgaggt cgcgcgctgg acggcggcag ggctgagcgc atacgacgcc       300
     gcgtacgtcg cggtcgccga ggcggcgggg atcgagctga tcactgcgga cgcgggcatc       360
     gtcgccgccg cgcccggcat cgcgcggggc ctggccgacg ccgccggctg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page