(data stored in ACNUC7421 zone)

EMBL: CP001854.PE143

CP001854.PE143       Location/Qualifiers
FT   CDS_pept        complement(143697..143969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0143"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_1545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48579"
FT                   /db_xref="GOA:D3F501"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:D3F501"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48579.1"
FT                   /translation="MATPSAHDHDASAATQRSSRDRARLVAVAILSVAAAAFALFNLDE
FT                   VKVNLILGSVQMPLFIVIVACLLIGAAIGAFLTRRGAKAGKTSRA"
     atggccactc cttcagcaca cgatcacgac gcatccgcgg cgacgcagcg ctccagcaga        60
     gacagagcgc gcctcgtcgc ggtcgcgatc ctctccgtcg cggccgcggc cttcgcgctc       120
     ttcaacctcg atgaggtgaa ggtcaacctg atactcggct cggtgcagat gccgctgttc       180
     atcgtgatcg tcgcgtgcct gctgatcggc gccgcgatcg gcgcgttcct cacacgccgc       240
     ggcgcgaagg ccggcaagac cagcagagcc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page