(data stored in ACNUC7421 zone)

EMBL: CP001854.PE144

CP001854.PE144       Location/Qualifiers
FT   CDS_pept        complement(144000..144602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0144"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: mxa:MXAN_2207 BioY family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48580"
FT                   /db_xref="GOA:D3F502"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D3F502"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADB48580.1"
FT                   /translation="MATAIAPTLPRRGLVLADAIPGARTRDIALVIGGALFTALLAQVA
FT                   IPVPPSPVPVTGQTLAVGLVGATLGARRGTAAMLLYALLGLFLPVYAEGNSGWDVITGA
FT                   SGGYIIGFIFATGVVGYLAERGADRKAVTAFLSFVAAQLIVFAFGLVGLKLAVGQDWSW
FT                   TVHNGFAIFIVGGVIKAIVGAAVLPSAWKLVRRFERG"
     atggccaccg caatcgcgcc cacactgccg cgccgcggcc tcgttctcgc cgacgcgata        60
     ccgggtgcgc gcacccgtga catcgcgctc gtgatcggcg gcgcgctgtt caccgcgctg       120
     ctggcgcagg tcgcgatccc cgtcccgccg tcgccggtcc cggtgaccgg ccagacgctc       180
     gccgtcggcc tcgtcggcgc gacgctcggc gcccgccgcg gcaccgccgc gatgctgctc       240
     tacgcgctgc tcggcctgtt tctgccggtc tacgccgagg gcaactccgg ctgggacgtc       300
     atcaccggcg ccagcggcgg ctacatcatc ggcttcatct tcgccaccgg cgtcgtcggc       360
     tacctcgccg agcgcggcgc cgatcgcaag gccgtcaccg cgttcctgtc gttcgtcgcg       420
     gcgcagctga tcgtcttcgc cttcggcctc gtcggcctca agctggccgt cggccaggac       480
     tggagctgga ccgtccacaa cggcttcgcg atcttcatcg tcggcggcgt gatcaaggcg       540
     atcgtcggcg cggccgtgct gccctccgcg tggaagctcg tcagacgctt cgagcgcggt       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page