(data stored in ACNUC7421 zone)

EMBL: CP001854.PE145

CP001854.PE145       Location/Qualifiers
FT   CDS_pept        complement(144816..145472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48581"
FT                   /db_xref="UniProtKB/TrEMBL:D3F503"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48581.1"
FT                   /translation="MLPFALQAVSECPAPADLALALGAEFEPIAADDAHAALDELGCDL
FT                   AAFRHVAPREQLVACAAAVGNRFTIVEERKRIGRESVFDDLLLHRVLRDGSGHALPLTI
FT                   AAVEAGRRAGIALGAVGRRREQYLAHAGLAAPHVADLRRRGPLVDLTGREEKVGWQCAH
FT                   QLSALLLDRIAERAERIGHLSWALRAAELRLALPVCAETRERMERELERVRTRLN"
     atgctcccct tcgccctcca agccgtctcc gaatgccccg ccccagcgga cctcgcgctc        60
     gcgctgggcg ccgagttcga gccgatcgcc gccgacgacg cccacgccgc gctcgacgag       120
     ctcggctgcg acctcgccgc gttccgtcac gtcgcgccgc gcgagcagct ggtcgcctgc       180
     gccgccgccg tcggcaaccg cttcaccatc gtggaggagc gcaagagaat cggccgcgag       240
     agcgtcttcg acgacctgct gctgcaccgt gtcctgcgtg acggcagcgg ccacgcgcta       300
     ccgctgacga tcgccgccgt cgaggccggc cgccgcgccg ggatcgcgct cggcgcggtc       360
     gggcgccggc gcgagcagta cctcgcgcac gccggcctcg ccgcgccgca cgtcgccgac       420
     ctgcggcgac gcggtccgct cgtcgacctg accggccgcg aggagaaggt cggctggcag       480
     tgcgcccacc agttgtccgc gctgctgctc gaccgcatcg ccgagcgtgc cgagcggatc       540
     ggccacctct cgtgggcgct gcgcgcggcc gagctgcgac tcgcgctgcc ggtctgcgcc       600
     gagacgcgcg agcggatgga gcgcgagctg gagcgcgtgc gaacgcgcct gaactag          657
//

If you have problems or comments...

PBIL Back to PBIL home page