(data stored in ACNUC7421 zone)

EMBL: CP001854.PE146

CP001854.PE146       Location/Qualifiers
FT   CDS_pept        145610..145969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0146"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   bpm:BURPS1710b_A1566 plastocyanin/azurin family copper
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48582"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:D3F504"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ADB48582.1"
FT                   /translation="MRRRVTCLALLSTGAAALLPAVTGAAGSSGSPAAHAAATRTVVLR
FT                   DIAFNPSRVTIHRGDRVTWQWRDGRTRHNVTSRSFRSASTRSSGSYSVTFGRPGTFAYH
FT                   CTLHPGMTGSVVVRR"
     atgcgacgac gcgtgacctg tctcgcgctg ctgtcgaccg gagccgcggc gctgcttccg        60
     gctgtcaccg gagcggccgg gtcctccggc tcgcccgcgg cgcatgccgc cgcgacccgc       120
     acggtcgtcc tgcgcgacat cgccttcaac cccagccgcg tgacgatcca ccgcggcgac       180
     cgcgtcacgt ggcagtggcg cgacggccgc acgcgccaca acgtcacgag ccgcagcttc       240
     cgaagcgcga gcacgcgcag cagcggctcc tactcggtca cgttcggccg cccgggcacg       300
     ttcgcgtacc actgcacgct ccaccccggc atgacgggga gcgtcgtcgt caggagatga       360
//

If you have problems or comments...

PBIL Back to PBIL home page