(data stored in ACNUC7421 zone)

EMBL: CP001854.PE147

CP001854.PE147       Location/Qualifiers
FT   CDS_pept        complement(145973..146386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0147"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mfa:Mfla_0494 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48583"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D3F505"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB48583.1"
FT                   /translation="MTTTPSDRHTIAFEPTEAVDAVQGPADGDRVEAVAHPAPGRYFAM
FT                   EEGGSERLLPLDRTITHLGRGFTADIQLEDVSVSRRHAIVTQRRGAVRILDDRSSNGTF
FT                   VNGRRIQEAELHDGDVVVIGRVVLQYVDVAPTT"
     atgaccacca cgccgtcgga ccgccatacc atcgcgttcg agccgacaga ggcggtcgac        60
     gcggtgcagg ggcccgcgga cggcgaccgt gtcgaagctg tcgcgcatcc cgccccgggc       120
     cgctacttcg cgatggagga gggcggcagc gaaaggctgc tcccgctgga ccgaacgatc       180
     acgcacctcg gccgcggctt caccgccgac atccagctcg aggacgtcag cgtctcgcgc       240
     cggcacgcga tcgtgacgca gcgacgcggc gcggtccgca tcctcgacga ccgcagctcc       300
     aacggcacgt tcgtcaacgg ccggcggatc caggaggcgg agctgcacga cggcgacgtc       360
     gtcgtgatcg ggcgcgtcgt gctgcagtac gtcgacgtcg cgcccacgac ctag             414
//

If you have problems or comments...

PBIL Back to PBIL home page