(data stored in ACNUC7421 zone)

EMBL: CP001854.PE148

CP001854.PE148       Location/Qualifiers
FT   CDS_pept        146558..147121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0148"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   eba:ebA4517 RNA polymerase sigma factor (sigma24)"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48584"
FT                   /db_xref="GOA:D3F506"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3F506"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADB48584.1"
FT                   /translation="MSSDAELLEASREDAGAFRELYERYALRVQGYHRRRTRSDDAAHD
FT                   LTAETFAQAWLGRARFRDEAGGSAGPWLFGIARHVLLASVRRGQLERIACERLGLFDRL
FT                   DCRPAAVEPQTAWLEDLDEDLDRALADLPAGQRDAIRLRVVDDLAYEQVAAALDTTPQA
FT                   ARVRVHRGLGALRTKLNHSTEASR"
     atgagcagcg acgcggagct gctggaagcg tcgcgcgagg acgcgggcgc cttccgcgag        60
     ctgtacgaac gctacgccct gcgcgtccag ggctatcacc ggcgccgtac gcgcagcgac       120
     gacgcggcgc acgacctgac ggccgagacg ttcgcgcagg cgtggctcgg gcgggcgcgc       180
     ttccgcgacg aggcgggcgg cagcgccggc ccgtggctgt tcgggatcgc ccgccacgtg       240
     ctgctcgcgt cggtccggcg cggccagctg gagcggatcg cctgcgagcg gctcggcctg       300
     ttcgaccggc tcgactgccg gccggccgcg gtcgagccgc agacggcctg gctggaggac       360
     ctcgacgagg acctcgaccg cgcgctcgcc gacctgcctg ccgggcagcg cgacgcgatc       420
     cgcctgcgcg tcgtcgacga cctcgcctac gagcaggtcg cggcggcgct cgacaccacg       480
     ccgcaggcgg cgcgggtccg cgtccaccgc gggctcggcg cgctgcggac gaagctgaac       540
     cactcgacgg aggcatcccg atga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page