(data stored in ACNUC7421 zone)

EMBL: CP001854.PE149

CP001854.PE149       Location/Qualifiers
FT   CDS_pept        147118..147657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48585"
FT                   /db_xref="GOA:D3F507"
FT                   /db_xref="UniProtKB/TrEMBL:D3F507"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48585.1"
FT                   /translation="MTTDLPPRLARLGDALEQAASADLAGASSAASAPASARARTTAGR
FT                   GRRPRRIALFAAAIAIAIPGAAIAGSQLIDTDEVADSIPAGSLWLAGTEPSCTVVRENV
FT                   EFHCTLGKAPSGEVLADWKGTVEPTVDASKRVNGGCRSLASDGRSWRCYIGSEAVEQRI
FT                   IGAGFLGDYAPTPGAG"
     atgacgaccg atctcccgcc gcgtctcgcc cgcctcggcg acgcgctcga acaggccgcg        60
     agcgccgacc tcgcgggcgc gagcagcgcg gcgagcgccc cggcgagcgc gcgtgcgcga       120
     acgacggccg gccgcggccg ccgcccccgg cggatcgcgc tgttcgccgc cgcgatcgcg       180
     atcgcgatcc ccggcgcggc gatcgccggc agtcagctga tcgacaccga cgaggtcgcc       240
     gacagcatcc ccgccggctc gctgtggctc gccggcaccg agccgtcgtg cacggtcgtg       300
     cgcgagaacg tcgagttcca ctgcacgctc gggaaggcgc cgagcggcga ggttctcgcg       360
     gactggaagg gaaccgtcga gccgaccgtc gacgcctcca agcgcgtcaa cggcggctgc       420
     cgctcgctcg cgagcgacgg gcgcagctgg cgctgctaca tcggcagcga ggccgtcgag       480
     cagagaatca tcggcgccgg cttcctcggc gactacgcgc cgacgcccgg ggccggttga       540
//

If you have problems or comments...

PBIL Back to PBIL home page