(data stored in ACNUC7421 zone)

EMBL: CP001854.PE15

CP001854.PE15        Location/Qualifiers
FT   CDS_pept        17790..19097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0015"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: dps:DP2425 cell
FT                   division protein (FtsW)"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48451"
FT                   /db_xref="GOA:D3EYP7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP7"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADB48451.1"
FT                   /translation="MSARNRELLGLIPASLLVTAGFAAVFIERGSLSQNELSDLSLTYG
FT                   AIFLGLCVAAHVFLRFALPYADPYLFPLVAVLACFGLVMIYRIDDTLARQQAQWFVVGL
FT                   ILFVATIVFLRDYRKLEQYRYLIAFGSLALLCLPRLPGIGAQVNGAYLGIRIPGVMVFQ
FT                   PTEFAKIGIVVFLASYLRDTRQVLVVGARRVLGVTLPPLKHFGPLLVIWGMAMLLLVVI
FT                   RDLGSSLMFFGAFLALIYVATDRFSFVLIGLVLFGLGGWYLGNTVPHVIDRVDVWMDPL
FT                   NPARYGNEGYQIANSLFAQADGGVLGRGFGGAMLESPFGDPILPAAQTDLIYALIVNEV
FT                   GLVGAVAVLMVYLLVVQRGFKIALLARDSFSTLLAVGLSAVFALQVFVIVGGVTNVIPL
FT                   TGVTLPFISYGGSSILANFVLLALLLLVSDKARRPA"
     gtgagcgccc gcaaccgcga gctgctcggg ctgatccccg cgtcgctgct cgtgaccgcg        60
     ggattcgccg ccgtcttcat cgagcggggc tcgttgtcgc agaacgagct gtcggacctg       120
     tcgctgacgt acggcgcgat cttcctcggc ctctgcgtcg cggcacacgt cttcctgcgc       180
     ttcgcgctgc cgtacgccga cccgtacctg ttcccgctcg tcgcggtgct ggcctgcttc       240
     gggctcgtga tgatctaccg gatcgacgac acgctcgcgc ggcagcaggc gcagtggttc       300
     gtcgtcgggc tgatcctgtt cgtcgcgacg atcgtcttcc tgcgcgacta ccgcaagctg       360
     gagcagtacc ggtacctgat cgcgttcggc agcctcgcgc tgctgtgcct gccgcgcctg       420
     ccggggatcg gcgcgcaggt caacggcgcc tacctcggga tccgcatccc cggcgtgatg       480
     gtcttccagc cgacggagtt cgcgaagatc gggatcgtcg tcttcctcgc cagctacctg       540
     cgcgacacgc gccaggtgct cgtcgtcggt gcgcgccgcg tgctcggcgt gacgctgccg       600
     ccgctgaagc acttcggccc gctgctggtg atctggggga tggcgatgct gctgctcgtc       660
     gtgatccgcg acctcggatc ctcgctgatg ttcttcggcg cgttcctcgc gctgatctac       720
     gtcgcgaccg accgcttctc gttcgtgctg atcgggctcg tgctgttcgg cctcggcggc       780
     tggtacctcg gcaacaccgt cccgcacgtg atcgaccgcg tcgacgtctg gatggacccg       840
     ctcaaccccg cccgttacgg gaacgagggg taccagatcg ccaactcgct gttcgcgcag       900
     gcggacggcg gcgtgctcgg gcgcggcttc ggcggcgcga tgctggagtc gccgttcggc       960
     gacccgatcc tgccggcggc gcagaccgac ctgatctacg cgctgatcgt caacgaggtc      1020
     ggcctcgtcg gcgcggtcgc ggtgctgatg gtctacctgc tcgtcgtcca gcgcggcttc      1080
     aagatcgcgc tgctggcgag agactcgttc tcgacgctgc tggccgtcgg gctctccgcc      1140
     gtcttcgcgc tgcaggtgtt cgtgatcgtc ggcggcgtca cgaacgtgat cccgctgacc      1200
     ggcgtcacgc tcccgttcat ctcctacggc ggctcgtcga tcctcgcgaa cttcgtcctg      1260
     ctcgcgctgc tgctgctcgt ctccgacaag gcacggcgac ccgcatga                   1308
//

If you have problems or comments...

PBIL Back to PBIL home page