(data stored in ACNUC7421 zone)

EMBL: CP001854.PE150

CP001854.PE150       Location/Qualifiers
FT   CDS_pept        complement(147688..149403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5598 OmpA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48586"
FT                   /db_xref="UniProtKB/TrEMBL:D3F508"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48586.1"
FT                   /translation="MDLIRKSPARRLGRWPALVLAALVAALALGATTAQTASADNFSCR
FT                   ASALRVDALVAGLGVDAEPTVANNGENPCAGESRRLVTLPPVLASVVSGGVSEADTTVS
FT                   ATGATARGAITDVALLRLLLGGVGLRATEATAGYQCVNGSPVPQTGGQVTGLTLFGTSV
FT                   LDTSAPVTLDLSANLLLGTLRLGTISLNQTTTTATSVTRTAVRITIAPNVDLGLLGILQ
FT                   PVLGPVLRGLLGADVVLGEARAGLVGNPCPPVVTPPTPRPPITPTETPVDPSLRPPIID
FT                   DGPPPRTPLTNATLLYHSTDSNVTLECRLDGGAWGACNGRSDYSNLSLGQHCFDVRSRR
FT                   GDRVSATTRYCWTVTELPAGCVASYRHGYFIKAGNAALGRRQAVFHATSRDGRIILTTR
FT                   SAPGILKLVQYTLNGARLASTANHVVEFAQLDKTRSQSLQVSVRGNGRSGRITRNFRYV
FT                   NYVALDCEGREVADGIAPRTVTVGGNRVTVKPDVPNEIRGTTKLRFFVQPARRHSLRAV
FT                   SFAINGRPLRQHLRSAVLTATQLKAGGAQTLTVRLTPNRGAPKTVTFTFTTNKT"
     atggacctca ttcgtaagtc gccggcgcga cgcctcggcc gttggccggc gctcgtgctc        60
     gccgcgctcg tcgcggcact cgcgctcggc gccaccaccg cgcagaccgc gtcggctgac       120
     aacttcagct gccgcgccag tgcgctccgc gtcgacgcgc tcgtcgcagg gctcggcgtc       180
     gacgccgagc cgaccgtcgc caacaacggc gagaatccat gcgccggcga gtcgagaaga       240
     ctcgtcacgc ttccacccgt cctcgccagc gtcgtcagcg gcggcgtctc ggaggcagac       300
     accaccgtca gcgccacggg cgcgacggcc cgcggcgcca tcaccgacgt cgcgctgctg       360
     agactgctgt tgggcggcgt cggcctcaga gccaccgagg cgaccgccgg ctatcagtgc       420
     gtcaacggca gcccggtccc ccagaccggc ggccaggtca ccggcctgac gctgttcggc       480
     acctcggtgc tcgacacgag cgcccccgtg acgctcgacc tgtcggcgaa cctcctgctc       540
     gggacgttga gactcgggac gatctcgctc aaccagacga cgacgacggc cacctcggtg       600
     acgcgaaccg cggtgcggat caccatcgcg ccgaacgtcg acctcgggtt gctcgggata       660
     ctccagccgg tcctcggacc ggtcctgaga gggctgctcg gcgccgacgt cgtgctcggc       720
     gaggcgagag cagggctcgt cggcaacccg tgcccgccgg tcgtcacgcc gccgacgccg       780
     agaccgccga taaccccgac cgagacaccg gtcgacccgt cgctcagacc gccgatcatc       840
     gacgacggcc cgccgccgag aacgccgctg acgaacgcga cgctgctgta ccactcgacc       900
     gattcgaacg tgacgctcga gtgccgcctc gacggcggcg cctggggcgc gtgcaacggc       960
     cgcagcgact acagcaacct ctcgctcggg cagcactgct tcgacgtgcg ttcccgtcgc      1020
     ggcgacagag tcagcgccac gacgcgctac tgctggacgg tgaccgagct gccggccggc      1080
     tgcgtggcct cgtaccggca cggctacttc atcaaggccg gcaacgcggc gctcggacgc      1140
     agacaggccg tcttccacgc cacatccaga gacggcagaa tcatcctcac gacgagatcg      1200
     gcgccgggga tcctcaagct ggtccagtac acgctcaacg gcgcgagact ggccagcacc      1260
     gcgaaccacg tcgtcgagtt cgcgcaactc gacaagacca gatcgcagtc gctccaggtg      1320
     agcgtccgcg gcaacgggag aagcgggcgg atcacccgta acttccgcta cgtcaactac      1380
     gtcgcgctcg actgcgaggg ccgcgaggtg gccgacggga tcgcaccgcg gacggtgacg      1440
     gtcggcggca accgcgtgac ggtcaagccg gacgtcccga acgagatccg cgggacgacg      1500
     aagctgcgct tcttcgtcca gccggccaga cggcactcgc tgcgcgccgt cagcttcgcg      1560
     atcaacggca gaccgctgcg ccagcatctg cgcagcgcgg tgctgaccgc cacccagctg      1620
     aaggcgggcg gcgcccagac gctgacggtc cggctcaccc ccaacagagg tgcaccgaag      1680
     accgtcacgt tcacgttcac gacgaacaag acctga                                1716
//

If you have problems or comments...

PBIL Back to PBIL home page