(data stored in ACNUC7421 zone)

EMBL: CP001854.PE151

CP001854.PE151       Location/Qualifiers
FT   CDS_pept        149745..150413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0151"
FT                   /product="Chlorite dismutase"
FT                   /note="PFAM: Chlorite dismutase; KEGG: dar:Daro_2580
FT                   chlorite dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48587"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D3F509"
FT                   /inference="protein motif:PFAM:PF06778"
FT                   /protein_id="ADB48587.1"
FT                   /translation="MTTDQNLYTLYAAFGAPAVRRLPEARRAAAAEEAQAALDAADVVV
FT                   RGSYSLAGFRAEADLLLWLVAASADALQDAVVAFRHTELGRSLDAHWTNIGVHREAEFA
FT                   KSHIPAYLAGKEPGRYVCVYPFVRSLDWYLLEPDARARMLREHGMMGRDYPDVLANTVS
FT                   AFALGDYEWLLAFEAEELTRIVDLMRHLRAAEARRHTREELPFFTGIRKGLADVVADLP
FT                   "
     gtgacgaccg accagaacct ctacacgctc tacgccgcgt tcggcgcgcc cgccgtgcga        60
     cggctgccgg aggcccgccg cgccgccgcg gcggaggagg cgcaggccgc gctcgacgcc       120
     gcggacgtgg tcgtccgcgg gagctactcg ctcgccggct tccgcgccga ggcggacctg       180
     ctgctgtggc tcgtcgccgc gtcggcggac gcgctgcagg acgccgtcgt cgctttccgt       240
     cacaccgagc tcggccgctc gctcgacgcg cattggacga acatcggcgt gcatcgcgag       300
     gccgagttcg cgaagtcgca catcccggcg tacctcgccg gcaaggagcc cggcagatac       360
     gtctgcgtct acccgttcgt gcggtcgctc gactggtacc tgctggagcc tgacgcgcgc       420
     gcgaggatgc tgcgcgagca cggcatgatg ggccgcgact accccgacgt cctggccaac       480
     acggtcagcg cgttcgcgct cggcgactac gagtggctgc tcgcgttcga ggcggaggag       540
     ctgacgcgga tcgtcgacct gatgcgccat ctgcgcgccg ccgaggcgcg gcggcacacg       600
     cgtgaggagc tgccgttctt caccggaatc cgcaagggcc tggccgatgt ggtcgcggac       660
     ctgccgtag                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page