(data stored in ACNUC7421 zone)

EMBL: CP001854.PE152

CP001854.PE152       Location/Qualifiers
FT   CDS_pept        150526..150981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48588"
FT                   /db_xref="UniProtKB/TrEMBL:D3F510"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48588.1"
FT                   /translation="MSDTLLAAIVGAVATLAAVGFAQLLNHAREARRARKASDEAWGRI
FT                   EIELGNVRESLDGIRVDDAWPIGWNAGWWSVWEKHSDALRCESDEERERFRTVQRAFGT
FT                   IDQLQHGVNTRRPDDGRGFTARDREFLDRVRAAIEAASGAVAGTARR"
     atgtcggaca cgctgctcgc agcgatcgtg ggcgcagtcg ccaccctcgc agccgtgggc        60
     ttcgcgcagc tgctgaacca cgcgcgcgag gcgaggcgcg cgcggaaggc gtccgacgag       120
     gcctgggggc ggatcgagat cgagctcgga aacgtccgcg agtcgctcga cgggattcga       180
     gtggacgacg cctggccgat cgggtggaac gcgggatggt ggtcggtgtg ggagaagcac       240
     agcgacgcgc tgagatgcga gtccgatgaa gagagagagc gcttccggac cgtccagcgc       300
     gcgttcggca cgatcgatca gctccagcac ggcgtcaaca cgcggcgtcc cgacgacggc       360
     cgcggcttca ccgcgcgtga ccgcgagttc ctcgaccggg tcagagccgc gatcgaggcg       420
     gcgtcgggcg cggtcgccgg caccgctcgc cgctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page