(data stored in ACNUC7421 zone)

EMBL: CP001854.PE153

CP001854.PE153       Location/Qualifiers
FT   CDS_pept        complement(150988..151911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0153"
FT                   /product="NAD(+) diphosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: pla:Plav_0254 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48589"
FT                   /db_xref="GOA:D3F511"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D3F511"
FT                   /inference="protein motif:PRIAM:3.6.1.22"
FT                   /protein_id="ADB48589.1"
FT                   /translation="MAEPNTFSGAQLDRASARRSDAAWVQARLHDRSSRALAITRDGVL
FT                   VTGYAEPQLVRLALDQIPGGAGATALLGVEPDGTTLFAVDVDHIHALRPLAPGARPLSL
FT                   REAGALLPHHLGGLAAYASALLNWHRVHGHCARCGAVTDVAEGGHMRRCPVCGAEHHPR
FT                   TDPVVIMLVLDGERVLLGRQAAWPAGRYSALAGFVEAGESLEEAVAREVLEESGVHVRE
FT                   PHYVSSQPWPFPSSLMLGFTATYAGGEPAALDGELEDVRWFTRAEVAAAAALPASADWD
FT                   DAPAGTSLLLPPPLAIARRLLDGWLG"
     atggccgagc cgaacacctt cagcggcgca cagctcgacc gggcgagcgc acgccggagc        60
     gacgcggcct gggtgcaggc gcggctgcac gaccgctcga gccgggcgct ggcgatcacg       120
     cgcgacggcg tgctcgtgac cggctacgcg gagccgcagc tcgtgcggct ggcgctcgac       180
     cagatcccgg gtggcgccgg cgccaccgcg ctgctcggcg tcgagcccga cggcacgacg       240
     ctgttcgccg tcgacgtcga ccacatccac gcgctgcgac cgctcgcacc gggcgcccgg       300
     ccgctgagcc tgcgcgaggc cggcgcgctg ctgccgcacc acctcggcgg cctcgccgcc       360
     tacgcctccg cgctgctcaa ctggcaccgc gtccacggcc actgcgcgcg ctgcggcgcc       420
     gtcaccgacg tcgccgaggg cggccacatg cgccgctgcc ccgtctgcgg ggccgagcac       480
     cacccgcgca ccgacccggt tgtgatcatg ctcgtgctcg acggcgagcg cgtgctgctc       540
     ggccgccagg cggcctggcc cgcagggcgc tactcggcgc tcgcggggtt cgtcgaggcc       600
     ggcgagtcgc tggaggaggc ggtcgcacgc gaggtgctgg aggagtccgg cgtccacgtg       660
     cgcgagccgc actacgtcag cagccagcca tggccgttcc ccagctcgct gatgctcggc       720
     ttcaccgcga cctacgcggg cggggagccg gcggcgctcg acggggagtt ggaggacgtg       780
     cgctggttca cgcgcgcaga ggtcgccgcc gcggcggcgc tgccggcttc cgccgactgg       840
     gacgacgcac ccgccggcac gtcgctgctg ctgccgccgc cgctcgcgat cgcgcggcgg       900
     ctgctcgacg gctggctggg ctga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page