(data stored in ACNUC7421 zone)

EMBL: CP001854.PE154

CP001854.PE154       Location/Qualifiers
FT   CDS_pept        151989..152594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0154"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: lch:Lcho_4033
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48590"
FT                   /db_xref="GOA:D3F512"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3F512"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48590.1"
FT                   /translation="MARRTAAAARATRDAIVARAVEIGSVDGLEGITIGRLADDLGLSK
FT                   SGVLNHFRTKELLQLAALSSAEEIFRREVWEPARDEPPGLRRLIALEDAWIDHVTGDAF
FT                   PGGCFWTAASAEFDGRPGSVRETVADALERWYATVRREVRAAMEAGELPPGTDPEQIVF
FT                   ELRGVAMTTNQQVQLHNDPAARDRARAAVRHILGSIAN"
     atggcacgca gaaccgcagc cgccgcccgc gcgacgcgcg acgcgatcgt ggcgcgcgcg        60
     gtcgagatcg gctccgtcga cgggctcgag ggcatcacga tcggccgcct cgcggacgat       120
     ctcggcctca gcaagtccgg cgtcctgaac catttccgca cgaaggagct gctgcagctc       180
     gccgcgctct cctccgcgga ggagatcttc agacgcgagg tgtgggagcc ggcgcgcgac       240
     gagccccccg ggctgcgccg gctgatcgcg ctggaagacg cgtggatcga ccacgtcacc       300
     ggcgacgcct ttcccggcgg ctgcttctgg acggccgcct cggccgagtt cgacggtcgc       360
     ccgggctcgg ttcgcgagac cgtcgccgac gcgctcgagc gctggtacgc gaccgtgcgg       420
     cgggaggtgc gcgccgcgat ggaggcgggc gagctgccgc ctggcaccga tccggagcag       480
     atcgtcttcg agctgcgcgg ggtcgcgatg acgacgaatc agcaggtgca gctgcacaac       540
     gaccccgcgg cgcgcgaccg tgcccgcgcg gcggttcggc acatcctcgg gtcgatcgca       600
     aattag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page