(data stored in ACNUC7421 zone)

EMBL: CP001854.PE155

CP001854.PE155       Location/Qualifiers
FT   CDS_pept        152667..154130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0155"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bvi:Bcep1808_4007 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48591"
FT                   /db_xref="GOA:D3F513"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3F513"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB48591.1"
FT                   /translation="MSGPAAPAATPLGSESPPAAPRPGRAIAVASAATFVAFLDVTVVN
FT                   VALPDLQRDFAGASLVTLSWVVAIYGVLFAALLTPAGRLADVIGRKTVFLAGFAGFTVT
FT                   SAISAVAPSVGLLIAARALQGASAAFMIPAALGIVLAVSAPEKRAAAVGLWGATTSVAA
FT                   AAGPALGGLLIDAFDWRAVFLINVPIGLVVLWAGWRVLPSIGRGAQQLPDLIGSALLAA
FT                   GFALVLVALTETAEWGWVDGRTAACLVAGVALLAVVLRRTRSHPAPAIELALLRNRAFA
FT                   VASAGAALYGVALFAWMLACVLFVTSVWGYSIIEAGLAVTPGAFSSAVAAVFAGRVVDR
FT                   HGPRGVVAGASLLFAAAGVWCVLGISAEPRFLTFWLPLGIVGGAGMGAVTVGLTGAAAR
FT                   ALPPAQFASGTGLAMTARQLGGALGVAALATILESAGVGVAGFRAVFAMCTVAALLTAL
FT                   SALWLARPAPTAAPAAAPLEPSKTAEVVA"
     atgtcaggcc cagccgcacc ggcggcgacg ccgctcggct ccgagtcgcc gcccgccgct        60
     cctcgccccg gtcgcgcgat agcggtcgcc tcggcggcga cgttcgtcgc gttcctcgac       120
     gtgacggtcg tcaacgtcgc gctgcccgac ctgcagcgcg acttcgccgg cgcctcgctc       180
     gtgaccctgt cgtgggtcgt cgcgatctac ggcgtgctgt tcgccgcgct gctgacgccg       240
     gccggacggc tcgccgacgt gatcggccgc aagaccgtct ttctcgccgg cttcgccggc       300
     ttcacggtga cgtccgcgat cagcgcggtc gcgccgtcgg tcgggctgct gatcgccgcc       360
     cgcgcgctgc agggcgccag cgccgcgttc atgatccccg ccgcgctcgg gatcgtgctc       420
     gccgtctccg cgccggagaa gcgcgccgcc gccgtcggcc tgtggggcgc gacgacgtcg       480
     gtcgccgcgg ctgccggccc cgcgctcggc ggccttctga tcgacgcctt cgactggcgc       540
     gccgtcttcc tcatcaacgt cccgatcggg ctcgtcgtgc tgtgggccgg ctggcgggtg       600
     ctgccgtcga tcggccgcgg cgcgcagcag ctgcccgacc tgatcggcag cgcgctgctc       660
     gccgccggct tcgcgctcgt gctcgtcgcg ctgaccgaga ccgccgagtg gggatgggtc       720
     gacggtcgca cggccgcgtg tctcgtcgcc ggcgtcgcgc tgctcgccgt cgtgctgcgg       780
     cgcacgcgct cgcatccggc gcccgcgatc gagctggcac tgctgcgcaa ccgcgcgttc       840
     gcggtcgcga gcgccggcgc ggcgctctac ggcgtcgcgc tgttcgcgtg gatgctcgcg       900
     tgcgtcctgt tcgtgacgtc ggtgtggggc tactcgatca tcgaggccgg cctcgctgtc       960
     acgcccggcg cgttcagctc cgctgtcgca gccgtgttcg ccggcagagt cgtcgaccgg      1020
     cacgggccgc gcggagtcgt cgccggcgcc tcgctgctgt tcgccgccgc cggcgtctgg      1080
     tgcgtgctgg ggatctcggc cgagccgcgc ttcctcacgt tctggctgcc gctcgggatc      1140
     gtcggcggcg ccggcatggg cgccgtcacc gtcgggctga ccggtgccgc cgcgcgggcg      1200
     ctgccgccgg cgcagttcgc ctccggcacc ggtctcgcga tgaccgcgcg ccagctcggc      1260
     ggcgcgctcg gcgtcgcggc gctcgcgacg atcctcgagt cggccggcgt cggggtcgcc      1320
     ggcttccgcg ccgtcttcgc gatgtgcacc gtcgctgcgc tgctgaccgc gctgagcgcg      1380
     ctctggctcg cgcggccggc ccccacggcg gcgcccgccg ccgcgcccct ggaaccctcg      1440
     aagaccgcgg aggtggtcgc atga                                             1464
//

If you have problems or comments...

PBIL Back to PBIL home page