(data stored in ACNUC7421 zone)

EMBL: CP001854.PE156

CP001854.PE156       Location/Qualifiers
FT   CDS_pept        154127..154897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0156"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   acp:A2cp1_0086 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48592"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D3F514"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADB48592.1"
FT                   /translation="MTTYPNELADPDVLGGHEEHALLRGAPWRRFAVLGDSVAAGVGER
FT                   VDGYLALTWAERVARGLRSHHPGLAYLNLGVRDLRAQQVRETQLAPALTFAPDLAAVIA
FT                   GGNDLLSRRFDPDAVARELEAIVAPLRDVGAEVFMFRLLDITLAIDVPEPYGTRLSERL
FT                   AALNDATSAVAERQQALVVAGAAHTRAADPPMYSSDLMHLNLRGQAVIGSEAIRELSRV
FT                   LAPPVEGEPLGLRPRVPSEELAQGLVLPAVESGG"
     atgacgacgt acccgaacga gctggccgac cccgacgtgc tcggcggcca cgaggagcac        60
     gcgctgctgc gcggcgcgcc gtggcggcgc ttcgccgtgc tcggcgacag cgtcgccgcc       120
     ggcgtcggcg agcgcgtcga cggctacctg gcgctgacgt gggccgagcg cgtcgcgcgc       180
     gggctgcgca gtcaccaccc cggcctcgca tacctcaacc tcggcgtccg tgacctgcgc       240
     gcgcagcagg tgcgagagac gcagctggcg ccggcgctca cgttcgcacc tgacctcgcc       300
     gccgtgatcg ccggcgggaa cgacctgctc tccagacggt tcgaccccga cgccgtcgcg       360
     cgcgagctgg aggcgatcgt cgctccgctg cgcgacgtcg gcgcggaggt cttcatgttc       420
     agactgctcg acatcacgct cgcgatcgac gtgccggagc cgtacgggac ccggctgtcg       480
     gagcggctcg ccgcgctcaa cgacgcgacg agcgccgtcg ccgagcgcca gcaggcgctg       540
     gtcgtcgccg gcgccgccca cacgcgcgcg gccgatccgc cgatgtacag cagcgacctg       600
     atgcatctca acctgcgcgg gcaggcggtc atcggcagcg aggcgatccg cgagctgtcg       660
     cgcgtcctgg cgccgccggt cgagggggaa ccgctcggcc tgcggcctcg ggttccgtcg       720
     gaagaactcg cccaggggct tgttcttccc gcggtagagt cgggcgggtg a                771
//

If you have problems or comments...

PBIL Back to PBIL home page