(data stored in ACNUC7421 zone)

EMBL: CP001854.PE157

CP001854.PE157       Location/Qualifiers
FT   CDS_pept        154894..155436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0157"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: oan:Oant_4146 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48593"
FT                   /db_xref="GOA:D3F515"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D3F515"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADB48593.1"
FT                   /translation="MSWTTLDSRIAYENRWIRVREDAVLRPDGERGIYGVVEMVAPAVF
FT                   VVALTEADEVVLITQRRYTTGQISVEVPAGATDGEEPLVAAQRELREETGLAAAEWRAL
FT                   GSMFALNGIADAPEHVFLATGLSDAGAGDERAAEGITAVERVPFAEAMRMMRDGEISDG
FT                   ETIASLALAAVALGRFA"
     gtgagctgga cgacgctcga ctcgcgcatc gcgtacgaga accgctggat ccgcgtgcgc        60
     gaggacgccg tgctgcggcc ggacggtgag cgaggcatct acggcgtcgt cgagatggtc       120
     gcgcccgccg tcttcgtcgt cgcgctgacc gaggcggacg aggtcgtgct gatcacccag       180
     cggcgataca cgaccgggca gatctccgtc gaggtgccgg ccggcgcgac cgacggcgag       240
     gagccgctcg tcgccgccca gcgcgagctg cgcgaggaga ccggcctcgc cgccgccgag       300
     tggcgcgcgc tcggctcgat gttcgcgctc aacgggatcg ccgacgcgcc cgagcacgtc       360
     ttcctcgcga ccggcctgtc ggacgcgggc gcgggcgacg agcgcgccgc ggaggggatc       420
     accgccgtcg agcgcgtgcc gttcgccgag gcgatgcgga tgatgcgcga cggcgagatc       480
     agcgacggcg agacgatcgc ctcgctcgcg ctcgccgccg tcgcgctcgg ccgcttcgcg       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page