(data stored in ACNUC7421 zone)

EMBL: CP001854.PE158

CP001854.PE158       Location/Qualifiers
FT   CDS_pept        complement(155528..156067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48594"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:D3F516"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48594.1"
FT                   /translation="MAGDWVFGYGSLAAEAHDGYVTALAGHRRRWGVAMDNARDLPGYK
FT                   WYRLCASGERPRGVVAFLDVVAGRGAVNGVCLPVDAGELRRLDARERNYERVEVTELVA
FT                   EARGRVWAYVGSAAGRARLAAGLRDGRALVSREYLDDVEDGFRRLGDEQLAAYRASTDP
FT                   PPPGCAVVALERVDLP"
     gtggcgggcg actgggtctt cggctacgga tcgctcgccg ccgaggcgca cgacggctac        60
     gtcaccgcgt tggccggcca ccgccgccgc tggggcgtcg cgatggacaa cgcgcgcgac       120
     ctgccgggct acaagtggta ccggctgtgc gcgagcggcg agcggccgcg cggcgtcgtc       180
     gccttcctcg acgtcgtcgc ggggaggggc gcggtcaacg gcgtctgcct gccggtcgac       240
     gccggcgagc tgcgccggct cgacgcgcgc gagcgcaact acgagcgcgt cgaggtgacc       300
     gagctggtcg cggaggcgcg cgggcgggtg tgggcctacg tcggcagcgc ggccgggcgc       360
     gcgcggctcg ccgccgggct gcgcgacggc cgcgcgctcg tcagccgcga gtacctcgac       420
     gacgtcgagg acggcttccg gcggctcggc gacgagcagc tggcggcgta ccgcgcctcg       480
     accgacccgc cgccgcccgg ctgcgcggtc gtcgcgctgg aacgggtcga cctgccgtag       540
//

If you have problems or comments...

PBIL Back to PBIL home page