(data stored in ACNUC7421 zone)

EMBL: CP001854.PE159

CP001854.PE159       Location/Qualifiers
FT   CDS_pept        complement(156079..157707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0159"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   xca:xccb100_0675 exported cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48595"
FT                   /db_xref="GOA:D3F517"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D3F517"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADB48595.1"
FT                   /translation="MRRLAPLILAGLLLASLGAATAHAGGRMISTPLSTKGARIVDAGG
FT                   RTVVLQGVNWFGFETANHLVHGLWARDYRDVLAQVRRLGFNTIRLPFSLEAIRSTAPVS
FT                   GADFSGGRNAALKGATPLEAMDAVVEEAGRQGLLILLDNHSHADDAYQQGLWYGQGFSE
FT                   DDWVATWKRLAARYRDQRNVIGADLKNEPHAEATWGTGGPTDWRRAAERAGNAVLSVAP
FT                   QWLVVVEGVGGGAPVPGQRLDTHWWGGNLEGVRTHPVRLDRANRLVYSPHEYGPGVFPQ
FT                   PWFGKPNTPALLEERWRTGFGFIAEQGIAPILVGEFGGRNVDRESAEGRWQRQFFDFIG
FT                   RTGASWTYWALNPNSGDTGGVLKDDWSSVQPAKTALLQRMIARQRIAFRGSGAVFTAPR
FT                   RATTPRRGGKAAPKTPARSQTAAPTQPSAPAQPPAQPPADDAPGPPAPGSLSARVVVEN
FT                   RWDAGWCGHLEVSGPDATLAAARATLTLPPGTRIAQSWNAQRSGDGGRVELRFPAWAKV
FT                   AGGAPYAATGFCVDGSGEAADVTVG"
     atgcgccgcc tcgcccccct catcctcgcc ggcctgctcc tcgcctcgct cggcgccgcg        60
     accgcccatg cgggtggccg gatgatctcc accccgctct cgacgaaggg cgcgcggatc       120
     gtcgacgccg gcggccgcac ggtcgtgctg cagggggtca actggttcgg cttcgagacc       180
     gccaaccatc tcgtccacgg gctgtgggcg cgcgactaca gagacgtcct cgcgcaggtc       240
     cgccggctcg gcttcaacac gatccgcctg ccgttctcgc tggaggcgat ccgctcgacg       300
     gcaccggtct ccggcgccga cttctccggc gggcggaacg ccgcgctgaa gggcgcgacg       360
     ccgctcgagg cgatggacgc ggtggtcgag gaggccggcc gccagggctt gctgatcctg       420
     ctcgacaacc actcgcacgc ggacgacgcc taccagcagg gcctctggta cggccagggc       480
     ttcagcgagg acgactgggt cgcgacctgg aagcggctcg ccgctcgcta ccgcgaccag       540
     cgcaacgtga tcggcgccga cctcaagaac gagccgcacg ccgaggcgac gtggggcacc       600
     ggcgggccga ccgactggcg ccgcgcggcc gagcgcgccg gcaacgcggt gctgtcggtc       660
     gcgccgcagt ggctcgtcgt ggtcgagggc gtcggcggcg gcgcgccggt ccccggccag       720
     cggctggaca cgcactggtg gggcggaaac ctcgaagggg tccgcacgca tccggtgcgg       780
     ctcgaccgcg ccaaccggct cgtctactcg ccgcacgagt acgggccggg cgtcttccca       840
     cagccgtggt tcggcaagcc gaacacgccg gcgctgctgg aggagcgttg gagaaccggc       900
     ttcggcttca tcgccgagca ggggatcgcg ccgatcctcg tcggcgagtt cggcggtcgc       960
     aacgtcgacc gggagagcgc cgagggccgc tggcagcggc agttcttcga cttcatcggc      1020
     cgcaccggcg cgtcgtggac gtactgggcg ctgaacccga actcgggcga caccggaggc      1080
     gtgctgaagg acgactggtc gagcgtgcag ccggcgaaga ccgcgctgct ccagcggatg      1140
     atcgcgcgcc agcggatcgc gttccgcggc agcggcgccg tcttcaccgc tccgcgccgc      1200
     gcgacgaccc cgagacgggg cgggaaggcg gcgccgaaga cgccggcgag atcgcagacg      1260
     gcggccccga cgcagccgag cgcgcccgcg cagccgcccg cacagccgcc cgccgacgac      1320
     gcgcccggcc cgccggcgcc cggctcgctg agcgcgcgcg tcgtcgtcga gaaccgctgg      1380
     gacgccggct ggtgcggtca cctcgaggtc agcggaccgg acgccacgct cgcggcggca      1440
     cgcgcgacgc tgacgctccc gcccggcacg cggatcgcgc agtcgtggaa cgcgcagcgc      1500
     tcgggcgacg gcggccgcgt cgagctgcgc ttcccggcgt gggcgaaggt cgccggtggc      1560
     gcgccgtacg cggcgaccgg cttctgcgtc gacggctcgg gcgaggccgc cgacgtgacc      1620
     gtcggctga                                                              1629
//

If you have problems or comments...

PBIL Back to PBIL home page